BLASTX nr result
ID: Ophiopogon26_contig00004784
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00004784 (784 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OVA02993.1| Reverse transcriptase zinc-binding domain [Maclea... 57 9e-06 >gb|OVA02993.1| Reverse transcriptase zinc-binding domain [Macleaya cordata] Length = 411 Score = 57.4 bits (137), Expect = 9e-06 Identities = 38/114 (33%), Positives = 50/114 (43%), Gaps = 4/114 (3%) Frame = -3 Query: 554 KRGWQEPDFCVTCECHVELVDHLLLSCSFVHDIWVKCAVYFRI----NIHMGESHCVWSR 387 KRG + C C E VDHLLL CSF ++IW F I + E Sbjct: 274 KRGMVVVNRCYLCCADGETVDHLLLHCSFANEIWTSFLAEFGIRWAFQNQVKEVFEEGIS 333 Query: 386 VVFWEDNGSLRGMLAMAICWNICKELNKMIFNCLSHSVEVCMYLICADIKFWAG 225 +F E L +L AICW + KE N+ FN V+ + I A + +W G Sbjct: 334 SIFAEHGNYLWRLLPYAICWVLWKERNERYFNDKEKGVDKIIMEIKAQLLYWLG 387