BLASTX nr result
ID: Ophiopogon26_contig00004761
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00004761 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241391.1| homeobox-leucine zipper protein HOX6-like [A... 64 1e-09 >ref|XP_020241391.1| homeobox-leucine zipper protein HOX6-like [Asparagus officinalis] gb|ONK58841.1| uncharacterized protein A4U43_C08F290 [Asparagus officinalis] Length = 224 Score = 63.5 bits (153), Expect = 1e-09 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = +3 Query: 6 GGLLVPSEQQQQFCFRQPSWPPDQSCATSQWWEFDR*NE 122 GG LVPSEQQ FCF QPSWP DQ+CA SQWWEF NE Sbjct: 188 GGSLVPSEQQ--FCFHQPSWPTDQACANSQWWEFWPMNE 224