BLASTX nr result
ID: Ophiopogon26_contig00004613
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00004613 (451 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010267478.1| PREDICTED: ATP synthase delta chain, chlorop... 55 5e-06 >ref|XP_010267478.1| PREDICTED: ATP synthase delta chain, chloroplastic [Nelumbo nucifera] Length = 235 Score = 54.7 bits (130), Expect = 5e-06 Identities = 26/56 (46%), Positives = 34/56 (60%) Frame = +2 Query: 248 STSLPAFSPDLVLKPTLKAHRKAATGYAAALLDVACCENVLNVIAKDARKVKRIVH 415 S LP+ P + P+ HRKAA+GYAAAL+D A C NVL + D R+ R+ H Sbjct: 65 SPFLPSSQPSSLRSPSPVVHRKAASGYAAALMDRARCSNVLEAVEHDVRRFSRLFH 120