BLASTX nr result
ID: Ophiopogon26_contig00004611
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00004611 (403 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023746412.1| probable serine/threonine-protein kinase nek... 55 3e-06 >ref|XP_023746412.1| probable serine/threonine-protein kinase nek3 [Lactuca sativa] Length = 264 Score = 55.1 bits (131), Expect = 3e-06 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Frame = -1 Query: 229 SAKANHSLTPLSTSLPTFS-PALVLKPTLQTHQKAATGYAAALLDVACCENALNVIAKDA 53 S + N LTP T LP+ S P + PT+ HQ AATGYAAAL+D A C N+L+ + KD Sbjct: 126 SYRHNEKLTP--TQLPSTSQPQPTISPTI--HQNAATGYAAALIDAALCSNSLDAVHKDV 181 Query: 52 RKL 44 ++L Sbjct: 182 KRL 184