BLASTX nr result
ID: Ophiopogon26_contig00003498
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00003498 (764 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020272372.1| uncharacterized protein LOC109847549 isoform... 57 8e-06 ref|XP_020272371.1| uncharacterized protein LOC109847549 isoform... 57 9e-06 ref|XP_020272370.1| uncharacterized protein LOC109847549 isoform... 57 9e-06 >ref|XP_020272372.1| uncharacterized protein LOC109847549 isoform X3 [Asparagus officinalis] Length = 433 Score = 57.4 bits (137), Expect = 8e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 149 PITFLQVKLAIQHMRKAIRKKANFDIMDLDTIKV 250 P+ VKLAIQHMRK IRKKANFDIMDLDTIKV Sbjct: 185 PLPKFTVKLAIQHMRKVIRKKANFDIMDLDTIKV 218 >ref|XP_020272371.1| uncharacterized protein LOC109847549 isoform X2 [Asparagus officinalis] Length = 550 Score = 57.4 bits (137), Expect = 9e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 149 PITFLQVKLAIQHMRKAIRKKANFDIMDLDTIKV 250 P+ VKLAIQHMRK IRKKANFDIMDLDTIKV Sbjct: 185 PLPKFTVKLAIQHMRKVIRKKANFDIMDLDTIKV 218 >ref|XP_020272370.1| uncharacterized protein LOC109847549 isoform X1 [Asparagus officinalis] gb|ONK62855.1| uncharacterized protein A4U43_C07F8840 [Asparagus officinalis] Length = 554 Score = 57.4 bits (137), Expect = 9e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 149 PITFLQVKLAIQHMRKAIRKKANFDIMDLDTIKV 250 P+ VKLAIQHMRK IRKKANFDIMDLDTIKV Sbjct: 185 PLPKFTVKLAIQHMRKVIRKKANFDIMDLDTIKV 218