BLASTX nr result
ID: Ophiopogon26_contig00003342
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00003342 (1303 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020246520.1| DNA polymerase alpha subunit B [Asparagus of... 40 4e-06 gb|PKA50073.1| hypothetical protein AXF42_Ash021104 [Apostasia s... 42 6e-06 >ref|XP_020246520.1| DNA polymerase alpha subunit B [Asparagus officinalis] gb|ONK57978.1| uncharacterized protein A4U43_C09F6390 [Asparagus officinalis] Length = 621 Score = 40.4 bits (93), Expect(2) = 4e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +3 Query: 1101 YLFRQLSRLVIESSHMDDFLSLIQNAMTEK 1190 YL RQLS LV+ESSHMD L IQN M EK Sbjct: 49 YLNRQLSGLVLESSHMDGLLLYIQNDMKEK 78 Score = 40.4 bits (93), Expect(2) = 4e-06 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +1 Query: 1183 RKKAIKAEPHLHIYSSNDVDM 1245 ++K IK EPHLHIYSSNDVDM Sbjct: 76 KEKLIKEEPHLHIYSSNDVDM 96 >gb|PKA50073.1| hypothetical protein AXF42_Ash021104 [Apostasia shenzhenica] Length = 594 Score = 42.4 bits (98), Expect(2) = 6e-06 Identities = 23/50 (46%), Positives = 33/50 (66%) Frame = +3 Query: 1041 FLVNFRVTELKSIFLMSFFLYLFRQLSRLVIESSHMDDFLSLIQNAMTEK 1190 + VNF+++ + + F YL R+L+ L IESSHMD FLS +QNA E+ Sbjct: 29 YCVNFKLSPVDLVANWEIF-YLNRELTGLDIESSHMDGFLSHLQNAQKER 77 Score = 37.7 bits (86), Expect(2) = 6e-06 Identities = 14/21 (66%), Positives = 19/21 (90%) Frame = +1 Query: 1183 RKKAIKAEPHLHIYSSNDVDM 1245 +++ +K EPHLHIYSSND+DM Sbjct: 75 KERLMKEEPHLHIYSSNDIDM 95