BLASTX nr result
ID: Ophiopogon26_contig00003007
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00003007 (503 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO62424.1| hypothetical protein CISIN_1g0346511mg, partial [... 74 1e-14 gb|PAN33600.1| hypothetical protein PAHAL_F00964 [Panicum hallii] 74 1e-14 ref|XP_020676321.1| small nuclear ribonucleoprotein E-like [Dend... 75 2e-14 ref|XP_010928628.2| PREDICTED: small nuclear ribonucleoprotein E... 76 2e-14 ref|XP_002278114.1| PREDICTED: small nuclear ribonucleoprotein E... 74 2e-14 dbj|GAY48435.1| hypothetical protein CUMW_111640 [Citrus unshiu]... 74 2e-14 ref|XP_008782085.1| PREDICTED: small nuclear ribonucleoprotein E... 74 3e-14 ref|XP_006453448.1| small nuclear ribonucleoprotein E [Citrus cl... 74 3e-14 ref|XP_010913620.1| PREDICTED: small nuclear ribonucleoprotein E... 74 4e-14 ref|XP_002454946.1| small nuclear ribonucleoprotein E [Sorghum b... 74 4e-14 ref|XP_015948775.1| small nuclear ribonucleoprotein E [Arachis d... 73 6e-14 ref|XP_020221607.1| small nuclear ribonucleoprotein E-like [Caja... 73 8e-14 ref|XP_006853328.1| small nuclear ribonucleoprotein E [Amborella... 73 8e-14 ref|NP_179464.1| Small nuclear ribonucleoprotein family protein ... 72 1e-13 ref|XP_011623817.1| small nuclear ribonucleoprotein E isoform X1... 72 1e-13 dbj|BAF22912.1| Os08g0151400, partial [Oryza sativa Japonica Gro... 72 1e-13 gb|ACF22772.1| small nuclear ribonucleoprotein E [Brachypodium d... 72 1e-13 ref|XP_013671423.1| small nuclear ribonucleoprotein E-like [Bras... 72 1e-13 emb|CDY52576.1| BnaCnng22610D [Brassica napus] 72 1e-13 ref|XP_020248105.1| small nuclear ribonucleoprotein E-like [Aspa... 72 2e-13 >gb|KDO62424.1| hypothetical protein CISIN_1g0346511mg, partial [Citrus sinensis] gb|KDO62425.1| hypothetical protein CISIN_1g0346511mg, partial [Citrus sinensis] Length = 44 Score = 73.9 bits (180), Expect = 1e-14 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +2 Query: 2 MNLVLDDTEELNVKKNTKKPLGRILLKGDNITLMMNTGK 118 MNLVLDD EE+++KKNT+KPLGRILLKGDNITLMMNTGK Sbjct: 6 MNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMNTGK 44 >gb|PAN33600.1| hypothetical protein PAHAL_F00964 [Panicum hallii] Length = 46 Score = 73.6 bits (179), Expect = 1e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +2 Query: 2 MNLVLDDTEELNVKKNTKKPLGRILLKGDNITLMMNTGK 118 MNLVLDD EE+NVKKNT+K LGRILLKGDNITLMMNTGK Sbjct: 8 MNLVLDDAEEINVKKNTRKSLGRILLKGDNITLMMNTGK 46 >ref|XP_020676321.1| small nuclear ribonucleoprotein E-like [Dendrobium catenatum] Length = 88 Score = 74.7 bits (182), Expect = 2e-14 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +2 Query: 2 MNLVLDDTEELNVKKNTKKPLGRILLKGDNITLMMNTGK 118 MNLVLDD +E+N+KKNT+KPLGRILLKGDNITLMMNTGK Sbjct: 50 MNLVLDDADEVNIKKNTRKPLGRILLKGDNITLMMNTGK 88 >ref|XP_010928628.2| PREDICTED: small nuclear ribonucleoprotein E [Elaeis guineensis] Length = 151 Score = 76.3 bits (186), Expect = 2e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 MNLVLDDTEELNVKKNTKKPLGRILLKGDNITLMMNTGK 118 MNLVLDD +ELNVKKNT+KPLGRILLKGDNITLMMNTGK Sbjct: 113 MNLVLDDADELNVKKNTRKPLGRILLKGDNITLMMNTGK 151 >ref|XP_002278114.1| PREDICTED: small nuclear ribonucleoprotein E [Vitis vinifera] emb|CBI15463.3| unnamed protein product, partial [Vitis vinifera] Length = 88 Score = 74.3 bits (181), Expect = 2e-14 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +2 Query: 2 MNLVLDDTEELNVKKNTKKPLGRILLKGDNITLMMNTGK 118 MNLVLDD EE+NVKKNTKK LGRILLKGDNITLMMNTGK Sbjct: 50 MNLVLDDAEEVNVKKNTKKTLGRILLKGDNITLMMNTGK 88 >dbj|GAY48435.1| hypothetical protein CUMW_111640 [Citrus unshiu] dbj|GAY48436.1| hypothetical protein CUMW_111640 [Citrus unshiu] Length = 79 Score = 73.9 bits (180), Expect = 2e-14 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +2 Query: 2 MNLVLDDTEELNVKKNTKKPLGRILLKGDNITLMMNTGK 118 MNLVLDD EE+++KKNT+KPLGRILLKGDNITLMMNTGK Sbjct: 41 MNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMNTGK 79 >ref|XP_008782085.1| PREDICTED: small nuclear ribonucleoprotein E-like [Phoenix dactylifera] Length = 88 Score = 73.9 bits (180), Expect = 3e-14 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +2 Query: 2 MNLVLDDTEELNVKKNTKKPLGRILLKGDNITLMMNTGK 118 MNLVLDD +ELN+KKNT+KPLGRILLKGDNITLMM+TGK Sbjct: 50 MNLVLDDADELNIKKNTRKPLGRILLKGDNITLMMSTGK 88 >ref|XP_006453448.1| small nuclear ribonucleoprotein E [Citrus clementina] ref|XP_006474134.1| PREDICTED: small nuclear ribonucleoprotein E [Citrus sinensis] gb|ESR66687.1| hypothetical protein CICLE_v10010045mg [Citrus clementina] gb|ESR66688.1| hypothetical protein CICLE_v10010045mg [Citrus clementina] Length = 88 Score = 73.9 bits (180), Expect = 3e-14 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +2 Query: 2 MNLVLDDTEELNVKKNTKKPLGRILLKGDNITLMMNTGK 118 MNLVLDD EE+++KKNT+KPLGRILLKGDNITLMMNTGK Sbjct: 50 MNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMNTGK 88 >ref|XP_010913620.1| PREDICTED: small nuclear ribonucleoprotein E isoform X1 [Elaeis guineensis] Length = 88 Score = 73.6 bits (179), Expect = 4e-14 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +2 Query: 2 MNLVLDDTEELNVKKNTKKPLGRILLKGDNITLMMNTGK 118 MNLVLDD +ELN+KK T+KPLGRILLKGDNITLMMNTGK Sbjct: 50 MNLVLDDADELNIKKKTRKPLGRILLKGDNITLMMNTGK 88 >ref|XP_002454946.1| small nuclear ribonucleoprotein E [Sorghum bicolor] gb|EES00066.1| hypothetical protein SORBI_3003G018600 [Sorghum bicolor] Length = 88 Score = 73.6 bits (179), Expect = 4e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +2 Query: 2 MNLVLDDTEELNVKKNTKKPLGRILLKGDNITLMMNTGK 118 MNLVLDD EE+NVKKNT+K LGRILLKGDNITLMMNTGK Sbjct: 50 MNLVLDDAEEINVKKNTRKSLGRILLKGDNITLMMNTGK 88 >ref|XP_015948775.1| small nuclear ribonucleoprotein E [Arachis duranensis] ref|XP_015948777.1| small nuclear ribonucleoprotein E [Arachis duranensis] ref|XP_015948778.1| small nuclear ribonucleoprotein E [Arachis duranensis] ref|XP_016200805.1| small nuclear ribonucleoprotein E [Arachis ipaensis] ref|XP_016183048.1| small nuclear ribonucleoprotein E [Arachis ipaensis] ref|XP_016183049.1| small nuclear ribonucleoprotein E [Arachis ipaensis] ref|XP_016183050.1| small nuclear ribonucleoprotein E [Arachis ipaensis] Length = 88 Score = 73.2 bits (178), Expect = 6e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +2 Query: 2 MNLVLDDTEELNVKKNTKKPLGRILLKGDNITLMMNTGK 118 MNLVLDD EE+NVKKNT+K LGRILLKGDNITLMMNTGK Sbjct: 50 MNLVLDDAEEVNVKKNTRKTLGRILLKGDNITLMMNTGK 88 >ref|XP_020221607.1| small nuclear ribonucleoprotein E-like [Cajanus cajan] Length = 88 Score = 72.8 bits (177), Expect = 8e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +2 Query: 2 MNLVLDDTEELNVKKNTKKPLGRILLKGDNITLMMNTGK 118 MNLVLDD EE+NVKKN+KK LGRILLKGDNITLMMNTGK Sbjct: 50 MNLVLDDAEEVNVKKNSKKTLGRILLKGDNITLMMNTGK 88 >ref|XP_006853328.1| small nuclear ribonucleoprotein E [Amborella trichopoda] ref|XP_011626589.1| small nuclear ribonucleoprotein E [Amborella trichopoda] ref|XP_011626590.1| small nuclear ribonucleoprotein E [Amborella trichopoda] gb|ERN14795.1| hypothetical protein AMTR_s00032p00069690 [Amborella trichopoda] Length = 88 Score = 72.8 bits (177), Expect = 8e-14 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +2 Query: 2 MNLVLDDTEELNVKKNTKKPLGRILLKGDNITLMMNTGK 118 MNLVLDD +ELN+K+NT+KPLGRILLKGDNITLMM+TGK Sbjct: 50 MNLVLDDADELNIKRNTRKPLGRILLKGDNITLMMSTGK 88 >ref|NP_179464.1| Small nuclear ribonucleoprotein family protein [Arabidopsis thaliana] ref|XP_002886267.1| small nuclear ribonucleoprotein E [Arabidopsis lyrata subsp. lyrata] ref|XP_006298890.1| small nuclear ribonucleoprotein E [Capsella rubella] ref|XP_006409116.1| small nuclear ribonucleoprotein E [Eutrema salsugineum] ref|XP_009150721.1| PREDICTED: small nuclear ribonucleoprotein E-like [Brassica rapa] ref|XP_010467707.1| PREDICTED: small nuclear ribonucleoprotein E [Camelina sativa] ref|XP_010489589.1| PREDICTED: small nuclear ribonucleoprotein E-like [Camelina sativa] ref|XP_013626395.1| PREDICTED: small nuclear ribonucleoprotein E-like [Brassica oleracea var. oleracea] ref|XP_013738060.1| small nuclear ribonucleoprotein E-like [Brassica napus] ref|XP_013727216.1| small nuclear ribonucleoprotein E-like [Brassica napus] ref|XP_018491781.1| PREDICTED: small nuclear ribonucleoprotein E-like [Raphanus sativus] gb|AAD08943.1| putative small nuclear ribonucleoprotein E [Arabidopsis thaliana] gb|AAM64436.1| putative small nuclear ribonucleoprotein E [Arabidopsis thaliana] dbj|BAC43399.1| putative small nuclear ribonucleoprotein E [Arabidopsis thaliana] gb|AAO64082.1| putative small nuclear ribonucleoprotein E [Arabidopsis thaliana] gb|EFH62526.1| hypothetical protein ARALYDRAFT_900374 [Arabidopsis lyrata subsp. lyrata] gb|AEC06800.1| Small nuclear ribonucleoprotein family protein [Arabidopsis thaliana] gb|EOA31788.1| hypothetical protein CARUB_v10015010mg [Capsella rubella] gb|ESQ50569.1| hypothetical protein EUTSA_v10022941mg [Eutrema salsugineum] Length = 88 Score = 72.4 bits (176), Expect = 1e-13 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +2 Query: 2 MNLVLDDTEELNVKKNTKKPLGRILLKGDNITLMMNTGK 118 MNLVLD+ EE+++KKNT+KPLGRILLKGDNITLMMNTGK Sbjct: 50 MNLVLDEAEEVSIKKNTRKPLGRILLKGDNITLMMNTGK 88 >ref|XP_011623817.1| small nuclear ribonucleoprotein E isoform X1 [Amborella trichopoda] Length = 88 Score = 72.4 bits (176), Expect = 1e-13 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +2 Query: 2 MNLVLDDTEELNVKKNTKKPLGRILLKGDNITLMMNTGK 118 MNLVLDD +E N+KKNT+KPLGRILLKGDNITLMM+TGK Sbjct: 50 MNLVLDDADEFNIKKNTRKPLGRILLKGDNITLMMSTGK 88 >dbj|BAF22912.1| Os08g0151400, partial [Oryza sativa Japonica Group] dbj|BAT03843.1| Os08g0151400, partial [Oryza sativa Japonica Group] Length = 64 Score = 71.6 bits (174), Expect = 1e-13 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +2 Query: 2 MNLVLDDTEELNVKKNTKKPLGRILLKGDNITLMMNTGK 118 MNLVLDD EE+NVKK+T+K LGRILLKGDNITLMMNTGK Sbjct: 26 MNLVLDDAEEINVKKDTRKSLGRILLKGDNITLMMNTGK 64 >gb|ACF22772.1| small nuclear ribonucleoprotein E [Brachypodium distachyon] Length = 79 Score = 72.0 bits (175), Expect = 1e-13 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +2 Query: 2 MNLVLDDTEELNVKKNTKKPLGRILLKGDNITLMMNTGK 118 MNLVL+D EE+NVKKNT+K LGRILLKGDNITLMMNTGK Sbjct: 41 MNLVLEDAEEINVKKNTRKSLGRILLKGDNITLMMNTGK 79 >ref|XP_013671423.1| small nuclear ribonucleoprotein E-like [Brassica napus] Length = 95 Score = 72.4 bits (176), Expect = 1e-13 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +2 Query: 2 MNLVLDDTEELNVKKNTKKPLGRILLKGDNITLMMNTGK 118 MNLVLD+ EE+++KKNT+KPLGRILLKGDNITLMMNTGK Sbjct: 57 MNLVLDEAEEVSIKKNTRKPLGRILLKGDNITLMMNTGK 95 >emb|CDY52576.1| BnaCnng22610D [Brassica napus] Length = 96 Score = 72.4 bits (176), Expect = 1e-13 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +2 Query: 2 MNLVLDDTEELNVKKNTKKPLGRILLKGDNITLMMNTGK 118 MNLVLD+ EE+++KKNT+KPLGRILLKGDNITLMMNTGK Sbjct: 45 MNLVLDEAEEVSIKKNTRKPLGRILLKGDNITLMMNTGK 83 >ref|XP_020248105.1| small nuclear ribonucleoprotein E-like [Asparagus officinalis] Length = 88 Score = 72.0 bits (175), Expect = 2e-13 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +2 Query: 2 MNLVLDDTEELNVKKNTKKPLGRILLKGDNITLMMNTGK 118 MNLVLDD EELNVKK T+K LGRILLKGDNITLMMNTGK Sbjct: 50 MNLVLDDAEELNVKKKTRKSLGRILLKGDNITLMMNTGK 88