BLASTX nr result
ID: Ophiopogon26_contig00002993
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00002993 (379 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK55778.1| uncharacterized protein A4U43_C10F890 [Asparagus ... 70 2e-11 ref|XP_020247840.1| LOW QUALITY PROTEIN: phospholipid scramblase... 70 2e-11 >gb|ONK55778.1| uncharacterized protein A4U43_C10F890 [Asparagus officinalis] Length = 302 Score = 69.7 bits (169), Expect = 2e-11 Identities = 32/58 (55%), Positives = 43/58 (74%) Frame = +3 Query: 117 MNSLRKISSRFLANRHNTCYRFGASARDEHTITRDWLAKLWAEDKKKLASLKSKQGNV 290 MNSLR+I +FL R N RFG+SAR E +ITRDWLAKLW E++KKLA ++ ++ + Sbjct: 2 MNSLRRIGPKFLETRPNLLCRFGSSARYEGSITRDWLAKLWTEERKKLAMIEKRRERI 59 >ref|XP_020247840.1| LOW QUALITY PROTEIN: phospholipid scramblase family protein C343.06c [Asparagus officinalis] Length = 312 Score = 69.7 bits (169), Expect = 2e-11 Identities = 32/58 (55%), Positives = 43/58 (74%) Frame = +3 Query: 117 MNSLRKISSRFLANRHNTCYRFGASARDEHTITRDWLAKLWAEDKKKLASLKSKQGNV 290 MNSLR+I +FL R N RFG+SAR E +ITRDWLAKLW E++KKLA ++ ++ + Sbjct: 2 MNSLRRIGPKFLETRPNLLCRFGSSARYEGSITRDWLAKLWTEERKKLAMIEKRRERI 59