BLASTX nr result
ID: Ophiopogon26_contig00002863
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00002863 (830 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA63798.1| victorin binding protein [Avena sativa] 58 8e-06 >gb|AAA63798.1| victorin binding protein [Avena sativa] Length = 1032 Score = 58.2 bits (139), Expect = 8e-06 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 103 AELDRFYDALISIRLEIAQIENGIADTNNNVLK 201 AELDRF DALISIR EIAQ+ENGIAD NNNVLK Sbjct: 930 AELDRFCDALISIREEIAQVENGIADVNNNVLK 962