BLASTX nr result
ID: Ophiopogon26_contig00002709
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00002709 (519 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247540.1| uncharacterized protein LOC109825167 isoform... 70 8e-11 ref|XP_020247523.1| uncharacterized protein LOC109825167 isoform... 68 4e-10 >ref|XP_020247540.1| uncharacterized protein LOC109825167 isoform X2 [Asparagus officinalis] gb|ONK80478.1| uncharacterized protein A4U43_C01F18140 [Asparagus officinalis] Length = 337 Score = 69.7 bits (169), Expect = 8e-11 Identities = 34/53 (64%), Positives = 39/53 (73%), Gaps = 1/53 (1%) Frame = +1 Query: 1 YDMLENQNTGGRTGSRHDEQPQIGWALPSTGQP-STSGRGMQGARSNSYSGGG 156 YDML+N NT RTG RH +Q Q GWALPSTGQP +TSG G +RSNS+ G G Sbjct: 282 YDMLDNSNTSVRTGGRHGDQLQSGWALPSTGQPNTTSGGGNSQSRSNSFGGRG 334 >ref|XP_020247523.1| uncharacterized protein LOC109825167 isoform X1 [Asparagus officinalis] ref|XP_020247531.1| uncharacterized protein LOC109825167 isoform X1 [Asparagus officinalis] Length = 338 Score = 67.8 bits (164), Expect = 4e-10 Identities = 35/54 (64%), Positives = 40/54 (74%), Gaps = 2/54 (3%) Frame = +1 Query: 1 YDMLENQNTGG-RTGSRHDEQPQIGWALPSTGQP-STSGRGMQGARSNSYSGGG 156 YDML+N NT G RTG RH +Q Q GWALPSTGQP +TSG G +RSNS+ G G Sbjct: 282 YDMLDNSNTTGVRTGGRHGDQLQSGWALPSTGQPNTTSGGGNSQSRSNSFGGRG 335