BLASTX nr result
ID: Ophiopogon26_contig00002653
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00002653 (536 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020268228.1| mitochondrial import receptor subunit TOM7-1... 93 1e-21 gb|OVA19284.1| Mitochondrial import receptor subunit TOM7 [Macle... 86 8e-19 ref|XP_009389359.1| PREDICTED: mitochondrial import receptor sub... 85 2e-18 ref|XP_009416416.1| PREDICTED: mitochondrial import receptor sub... 84 3e-18 ref|XP_003530621.1| PREDICTED: mitochondrial import receptor sub... 84 3e-18 gb|AAS21011.1| unknown [Hyacinthus orientalis] 84 3e-18 ref|XP_010263429.1| PREDICTED: mitochondrial import receptor sub... 84 4e-18 ref|XP_003525317.1| PREDICTED: mitochondrial import receptor sub... 84 5e-18 ref|XP_008810028.1| PREDICTED: mitochondrial import receptor sub... 83 7e-18 ref|XP_004503550.1| PREDICTED: mitochondrial import receptor sub... 83 7e-18 gb|AFK44684.1| unknown [Lotus japonicus] 83 1e-17 ref|XP_022009339.1| mitochondrial import receptor subunit TOM7-1... 83 1e-17 gb|OMO88291.1| Mitochondrial import receptor [Corchorus capsularis] 82 1e-17 gb|OMO80594.1| Mitochondrial import receptor subunit TOM7 [Corch... 82 1e-17 ref|XP_012463735.1| PREDICTED: mitochondrial import receptor sub... 82 1e-17 ref|XP_016675737.1| PREDICTED: mitochondrial import receptor sub... 82 1e-17 ref|XP_009406780.1| PREDICTED: mitochondrial import receptor sub... 82 1e-17 ref|XP_021632247.1| mitochondrial import receptor subunit TOM7-1... 82 1e-17 ref|XP_007225789.1| mitochondrial import receptor subunit TOM7-1... 82 2e-17 gb|KMZ71327.1| putative Mitochondrial import receptor subunit TO... 82 2e-17 >ref|XP_020268228.1| mitochondrial import receptor subunit TOM7-1 [Asparagus officinalis] Length = 73 Score = 92.8 bits (229), Expect = 1e-21 Identities = 42/47 (89%), Positives = 43/47 (91%) Frame = -3 Query: 387 YVKCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSSLLSP 247 Y KC KEWTTWAMKKAKV THYGFIPLIIVIGMN+EPKPTLS LLSP Sbjct: 26 YGKCVKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLLSP 72 >gb|OVA19284.1| Mitochondrial import receptor subunit TOM7 [Macleaya cordata] Length = 71 Score = 85.5 bits (210), Expect = 8e-19 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -3 Query: 384 VKCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSSLLSP 247 VKC KEW+TWAMKKAKV THYGFIPL+I+IGMN+EPKP L+ L+SP Sbjct: 25 VKCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLAQLISP 70 >ref|XP_009389359.1| PREDICTED: mitochondrial import receptor subunit TOM7-2-like [Musa acuminata subsp. malaccensis] Length = 73 Score = 84.7 bits (208), Expect = 2e-18 Identities = 38/45 (84%), Positives = 40/45 (88%) Frame = -3 Query: 381 KCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSSLLSP 247 KC KEW+TWAMKKAKV THYGFIPLIIVIGMN+EPKP L LLSP Sbjct: 28 KCVKEWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQLYQLLSP 72 >ref|XP_009416416.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Musa acuminata subsp. malaccensis] Length = 71 Score = 84.0 bits (206), Expect = 3e-18 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -3 Query: 381 KCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSSLLSP 247 KC KEW+TWAMKKAKV THYGFIPLI++IGMN+EPKP L LLSP Sbjct: 26 KCVKEWSTWAMKKAKVITHYGFIPLIVIIGMNSEPKPQLYQLLSP 70 >ref|XP_003530621.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Glycine max] gb|KHN16697.1| Mitochondrial import receptor subunit TOM7-1 [Glycine soja] gb|KRH41405.1| hypothetical protein GLYMA_08G027900 [Glycine max] Length = 72 Score = 84.0 bits (206), Expect = 3e-18 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -3 Query: 381 KCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSSLLSP 247 +C KEWTTWAM+KAKV THYGFIPL+IVIGMN++PKP LS LLSP Sbjct: 27 ECLKEWTTWAMRKAKVITHYGFIPLVIVIGMNSDPKPPLSQLLSP 71 >gb|AAS21011.1| unknown [Hyacinthus orientalis] Length = 72 Score = 84.0 bits (206), Expect = 3e-18 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -3 Query: 372 KEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSSLLSP 247 KEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPT L+SP Sbjct: 30 KEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTFYQLVSP 71 >ref|XP_010263429.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Nelumbo nucifera] Length = 89 Score = 84.3 bits (207), Expect = 4e-18 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = -3 Query: 384 VKCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSSLLSP 247 VKC K+W+TW MKKAKV THYGFIPL+I+IG+N+EPKPTLS LL+P Sbjct: 43 VKCLKDWSTWTMKKAKVITHYGFIPLVIIIGVNSEPKPTLSQLLTP 88 >ref|XP_003525317.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Glycine max] gb|KHM99855.1| Mitochondrial import receptor subunit TOM7-1 [Glycine soja] gb|KRH60119.1| hypothetical protein GLYMA_05G2214001 [Glycine max] Length = 72 Score = 83.6 bits (205), Expect = 5e-18 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = -3 Query: 381 KCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSSLLSP 247 +C KEWTTWAM+KAKV THYGFIPL+I+IGMN++PKP LS LLSP Sbjct: 27 ECLKEWTTWAMRKAKVITHYGFIPLVIIIGMNSDPKPPLSQLLSP 71 >ref|XP_008810028.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Phoenix dactylifera] Length = 72 Score = 83.2 bits (204), Expect = 7e-18 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -3 Query: 381 KCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSSLLSP 247 +C K W+TWAMKKAKV THYGFIPLII+IGMN+EPKP LS LLSP Sbjct: 27 RCVKTWSTWAMKKAKVITHYGFIPLIIIIGMNSEPKPQLSQLLSP 71 >ref|XP_004503550.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Cicer arietinum] Length = 72 Score = 83.2 bits (204), Expect = 7e-18 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = -3 Query: 387 YVKCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSSLLSP 247 YV C KEWTTW ++KAKV THYGFIP+II+IGMN++PKP LS LLSP Sbjct: 25 YVDCMKEWTTWGLRKAKVITHYGFIPMIILIGMNSDPKPQLSQLLSP 71 >gb|AFK44684.1| unknown [Lotus japonicus] Length = 72 Score = 82.8 bits (203), Expect = 1e-17 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -3 Query: 381 KCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSSLLSP 247 +C KEWTTW M+KAKV THYGFIPLII+IGMN++PKP LS LLSP Sbjct: 27 ECLKEWTTWTMRKAKVVTHYGFIPLIIIIGMNSDPKPQLSQLLSP 71 >ref|XP_022009339.1| mitochondrial import receptor subunit TOM7-1-like [Helianthus annuus] gb|OTF97696.1| putative outer membrane translocase complex, subunit Tom7 [Helianthus annuus] Length = 73 Score = 82.8 bits (203), Expect = 1e-17 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = -3 Query: 381 KCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSSLLSP 247 K KEWTTW MKKAKV THYGFIPLII IGMN+EPKPT+S LLSP Sbjct: 28 KVLKEWTTWTMKKAKVVTHYGFIPLIIFIGMNSEPKPTISQLLSP 72 >gb|OMO88291.1| Mitochondrial import receptor [Corchorus capsularis] Length = 72 Score = 82.4 bits (202), Expect = 1e-17 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -3 Query: 384 VKCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSSLLSP 247 V+C KEW+TWA+KKAKV THYGFIPL+I+IGMN+EPKP L LLSP Sbjct: 26 VQCLKEWSTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPQLYQLLSP 71 >gb|OMO80594.1| Mitochondrial import receptor subunit TOM7 [Corchorus olitorius] Length = 72 Score = 82.4 bits (202), Expect = 1e-17 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -3 Query: 384 VKCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSSLLSP 247 V+C KEW+TWA+KKAKV THYGFIPL+I+IGMN+EPKP L LLSP Sbjct: 26 VQCLKEWSTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPQLYQLLSP 71 >ref|XP_012463735.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Gossypium raimondii] ref|XP_012463736.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Gossypium raimondii] gb|KJB81174.1| hypothetical protein B456_013G132400 [Gossypium raimondii] gb|KJB81175.1| hypothetical protein B456_013G132400 [Gossypium raimondii] gb|PPD94483.1| hypothetical protein GOBAR_DD08498 [Gossypium barbadense] Length = 72 Score = 82.4 bits (202), Expect = 1e-17 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -3 Query: 381 KCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSSLLSP 247 +C KEW+TWAMKKAKV THYGFIPL+I+IGMN+EPKP L LLSP Sbjct: 27 QCLKEWSTWAMKKAKVVTHYGFIPLVIIIGMNSEPKPQLYQLLSP 71 >ref|XP_016675737.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Gossypium hirsutum] ref|XP_016703287.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Gossypium hirsutum] ref|XP_017608704.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Gossypium arboreum] gb|KHG28073.1| Mitochondrial import receptor subunit TOM7-1 -like protein [Gossypium arboreum] gb|PPR94623.1| hypothetical protein GOBAR_AA26047 [Gossypium barbadense] Length = 72 Score = 82.4 bits (202), Expect = 1e-17 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -3 Query: 381 KCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSSLLSP 247 +C KEW+TWAMKKAKV THYGFIPL+I+IGMN+EPKP L LLSP Sbjct: 27 QCLKEWSTWAMKKAKVVTHYGFIPLVIIIGMNSEPKPQLYQLLSP 71 >ref|XP_009406780.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Musa acuminata subsp. malaccensis] ref|XP_018682998.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Musa acuminata subsp. malaccensis] Length = 72 Score = 82.4 bits (202), Expect = 1e-17 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = -3 Query: 381 KCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSSLLSP 247 KC KEW+TWAMKKAKV THYGFIPLII IGMN+EPKP L LLSP Sbjct: 27 KCFKEWSTWAMKKAKVITHYGFIPLIITIGMNSEPKPQLYQLLSP 71 >ref|XP_021632247.1| mitochondrial import receptor subunit TOM7-1-like [Manihot esculenta] gb|OAY33764.1| hypothetical protein MANES_13G122700 [Manihot esculenta] Length = 74 Score = 82.4 bits (202), Expect = 1e-17 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -3 Query: 381 KCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSSLLSP 247 +C KEW+TWAMKKAKV THYGFIPL+I+IGMN+EPKP L LLSP Sbjct: 29 QCLKEWSTWAMKKAKVVTHYGFIPLVIIIGMNSEPKPQLYQLLSP 73 >ref|XP_007225789.1| mitochondrial import receptor subunit TOM7-1 [Prunus persica] ref|XP_008223958.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Prunus mume] ref|XP_021825143.1| mitochondrial import receptor subunit TOM7-1 [Prunus avium] gb|ONI27067.1| hypothetical protein PRUPE_1G065700 [Prunus persica] Length = 73 Score = 82.0 bits (201), Expect = 2e-17 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -3 Query: 372 KEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSSLLSP 247 KEW+TWAMKKAKV THYGFIPLIIVIGMN+EPKP LS LLSP Sbjct: 31 KEWSTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPQLSQLLSP 72 >gb|KMZ71327.1| putative Mitochondrial import receptor subunit TOM7-1 [Zostera marina] Length = 69 Score = 81.6 bits (200), Expect = 2e-17 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -3 Query: 384 VKCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSSLLSP 247 VKC K WTTWAMKKAK+ H+GFIPL+IV+GMN+EPKP LS LLSP Sbjct: 23 VKCVKVWTTWAMKKAKLIVHWGFIPLVIVVGMNSEPKPPLSQLLSP 68