BLASTX nr result
ID: Ophiopogon26_contig00002537
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00002537 (493 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273018.1| uncharacterized protein LOC109848103 isoform... 55 7e-06 ref|XP_020273013.1| uncharacterized protein LOC109848103 isoform... 55 7e-06 >ref|XP_020273018.1| uncharacterized protein LOC109848103 isoform X2 [Asparagus officinalis] ref|XP_020273020.1| uncharacterized protein LOC109848103 isoform X2 [Asparagus officinalis] Length = 480 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +3 Query: 198 LLFASQYNEEQSIIRASSPSADLVATTNINHIVFAISSS 314 L F QYNEE +IRASS S +LVATT +NHIVFAIS+S Sbjct: 43 LFFKHQYNEEDPLIRASSSSGNLVATTTVNHIVFAISAS 81 >ref|XP_020273013.1| uncharacterized protein LOC109848103 isoform X1 [Asparagus officinalis] ref|XP_020273014.1| uncharacterized protein LOC109848103 isoform X1 [Asparagus officinalis] ref|XP_020273015.1| uncharacterized protein LOC109848103 isoform X1 [Asparagus officinalis] ref|XP_020273016.1| uncharacterized protein LOC109848103 isoform X1 [Asparagus officinalis] ref|XP_020273017.1| uncharacterized protein LOC109848103 isoform X1 [Asparagus officinalis] Length = 546 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +3 Query: 198 LLFASQYNEEQSIIRASSPSADLVATTNINHIVFAISSS 314 L F QYNEE +IRASS S +LVATT +NHIVFAIS+S Sbjct: 109 LFFKHQYNEEDPLIRASSSSGNLVATTTVNHIVFAISAS 147