BLASTX nr result
ID: Ophiopogon26_contig00000855
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00000855 (500 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK77301.1| uncharacterized protein A4U43_C02F5130 [Asparagus... 81 9e-17 ref|XP_020252933.1| cytochrome b5-like [Asparagus officinalis] 81 2e-16 ref|XP_020249842.1| cytochrome b5-like [Asparagus officinalis] 65 3e-10 ref|XP_010930312.1| PREDICTED: cytochrome B5 [Elaeis guineensis] 58 2e-07 ref|XP_008801169.1| PREDICTED: cytochrome b5-like [Phoenix dacty... 54 5e-06 ref|XP_020703747.1| cytochrome b5-like [Dendrobium catenatum] >g... 54 6e-06 >gb|ONK77301.1| uncharacterized protein A4U43_C02F5130 [Asparagus officinalis] Length = 116 Score = 81.3 bits (199), Expect = 9e-17 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 387 RNKALLEKKQPPSSGFTDFLLPILVLALAFGAWYYLTFINVKA 259 RNKALLEKKQPPSSGF+ FLLP+LVLALAF AWYYLT+INVKA Sbjct: 74 RNKALLEKKQPPSSGFSGFLLPLLVLALAFAAWYYLTYINVKA 116 >ref|XP_020252933.1| cytochrome b5-like [Asparagus officinalis] Length = 142 Score = 81.3 bits (199), Expect = 2e-16 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 387 RNKALLEKKQPPSSGFTDFLLPILVLALAFGAWYYLTFINVKA 259 RNKALLEKKQPPSSGF+ FLLP+LVLALAF AWYYLT+INVKA Sbjct: 100 RNKALLEKKQPPSSGFSGFLLPLLVLALAFAAWYYLTYINVKA 142 >ref|XP_020249842.1| cytochrome b5-like [Asparagus officinalis] Length = 141 Score = 65.1 bits (157), Expect = 3e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -3 Query: 387 RNKALLEKKQPPSSGFTDFLLPILVLALAFGAWYYLTFIN 268 RNKALLE PSS FTD+LLP+LVLALAFG+WYYLTFIN Sbjct: 103 RNKALLEA---PSSSFTDYLLPLLVLALAFGSWYYLTFIN 139 >ref|XP_010930312.1| PREDICTED: cytochrome B5 [Elaeis guineensis] Length = 148 Score = 57.8 bits (138), Expect = 2e-07 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -3 Query: 381 KALLEKKQPPSSGFTDFLLPILVLALAFGAWYYLTF 274 + L E++ PPSS F D LLP+L+L LAFGAWYYLTF Sbjct: 107 RTLKERRPPPSSSFLDLLLPVLILGLAFGAWYYLTF 142 >ref|XP_008801169.1| PREDICTED: cytochrome b5-like [Phoenix dactylifera] Length = 148 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = -3 Query: 387 RNKALLEKKQPPSSGFTDFLLPILVLALAFGAWYYLTF 274 R + L +++ SSGF D LLP+LVL LAFGAWYYLTF Sbjct: 105 RARTLQQRQPQTSSGFLDLLLPVLVLGLAFGAWYYLTF 142 >ref|XP_020703747.1| cytochrome b5-like [Dendrobium catenatum] gb|PKU80322.1| Cytochrome b5 [Dendrobium catenatum] Length = 141 Score = 53.5 bits (127), Expect = 6e-06 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = -3 Query: 384 NKALLEKKQPPSSGFTDFLLPILVLALAFGAWYYLTFINVKA 259 NK K+ S+ F D LLP+L+LALAF AWYYLT+INV A Sbjct: 100 NKPQEMKQATSSTSFMDILLPLLILALAFAAWYYLTYINVNA 141