BLASTX nr result
ID: Ophiopogon26_contig00000418
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00000418 (428 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30669.3| unnamed protein product, partial [Vitis vinifera] 118 1e-31 ref|XP_020254639.1| 50S ribosomal protein L34, chloroplastic-lik... 119 1e-31 ref|XP_007025416.1| PREDICTED: 50S ribosomal protein L34, chloro... 119 2e-31 ref|XP_024198015.1| 50S ribosomal protein L34, chloroplastic [Ro... 118 2e-31 ref|XP_016754071.1| PREDICTED: 50S ribosomal protein L34, chloro... 118 3e-31 ref|XP_016683329.1| PREDICTED: 50S ribosomal protein L34, chloro... 118 3e-31 ref|XP_012450509.1| PREDICTED: 50S ribosomal protein L34, chloro... 118 3e-31 ref|XP_016687506.1| PREDICTED: 50S ribosomal protein L34, chloro... 118 3e-31 ref|XP_012445398.1| PREDICTED: 50S ribosomal protein L34, chloro... 118 3e-31 ref|XP_008225220.1| PREDICTED: 50S ribosomal protein L34, chloro... 116 3e-31 ref|XP_002274637.3| PREDICTED: 50S ribosomal protein L34, chloro... 118 3e-31 emb|CAN60201.1| hypothetical protein VITISV_036402 [Vitis vinifera] 118 3e-31 ref|XP_020102270.1| 50S ribosomal protein L34, chloroplastic-lik... 118 4e-31 ref|XP_022721086.1| 50S ribosomal protein L34, chloroplastic-lik... 118 4e-31 ref|XP_021599506.1| 50S ribosomal protein L34, chloroplastic-lik... 118 5e-31 ref|XP_010277750.1| PREDICTED: 50S ribosomal protein L34, chloro... 117 5e-31 ref|XP_021293910.1| 50S ribosomal protein L34, chloroplastic [He... 117 6e-31 ref|XP_004293930.1| PREDICTED: 50S ribosomal protein L34, chloro... 117 7e-31 ref|XP_017631621.1| PREDICTED: 50S ribosomal protein L34, chloro... 117 7e-31 gb|OMO65329.1| Ribosomal protein L34 [Corchorus olitorius] 115 8e-31 >emb|CBI30669.3| unnamed protein product, partial [Vitis vinifera] Length = 113 Score = 118 bits (295), Expect = 1e-31 Identities = 58/62 (93%), Positives = 60/62 (96%) Frame = +1 Query: 202 VRAGKAVLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRQVLCTKSNPNSGK 381 VRAGKA LC TKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGR+VLCTKSNP+SGK Sbjct: 52 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPSSGK 111 Query: 382 RA 387 RA Sbjct: 112 RA 113 >ref|XP_020254639.1| 50S ribosomal protein L34, chloroplastic-like [Asparagus officinalis] gb|ONK78486.1| uncharacterized protein A4U43_C02F19270 [Asparagus officinalis] Length = 143 Score = 119 bits (297), Expect = 1e-31 Identities = 58/62 (93%), Positives = 61/62 (98%) Frame = +1 Query: 202 VRAGKAVLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRQVLCTKSNPNSGK 381 VRAGKA LC+TKR+RSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGR+VLCTKSNPNSGK Sbjct: 82 VRAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGK 141 Query: 382 RA 387 RA Sbjct: 142 RA 143 >ref|XP_007025416.1| PREDICTED: 50S ribosomal protein L34, chloroplastic [Theobroma cacao] gb|EOY28038.1| 50S ribosomal protein L34 [Theobroma cacao] Length = 158 Score = 119 bits (297), Expect = 2e-31 Identities = 58/62 (93%), Positives = 60/62 (96%) Frame = +1 Query: 202 VRAGKAVLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRQVLCTKSNPNSGK 381 VRAGKA LC TKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGR+VLCTKSNPNSGK Sbjct: 97 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGK 156 Query: 382 RA 387 R+ Sbjct: 157 RS 158 >ref|XP_024198015.1| 50S ribosomal protein L34, chloroplastic [Rosa chinensis] gb|PRQ29111.1| putative ribosomal protein L34 [Rosa chinensis] Length = 149 Score = 118 bits (296), Expect = 2e-31 Identities = 57/62 (91%), Positives = 61/62 (98%) Frame = +1 Query: 202 VRAGKAVLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRQVLCTKSNPNSGK 381 VRAGKA LC+TKRNRSRKSLARTHGFRRRMRTTSGRA+LKRRRAKGR+VLCTK+NPNSGK Sbjct: 88 VRAGKAALCLTKRNRSRKSLARTHGFRRRMRTTSGRAMLKRRRAKGRKVLCTKTNPNSGK 147 Query: 382 RA 387 RA Sbjct: 148 RA 149 >ref|XP_016754071.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Gossypium hirsutum] Length = 152 Score = 118 bits (296), Expect = 3e-31 Identities = 58/61 (95%), Positives = 59/61 (96%) Frame = +1 Query: 202 VRAGKAVLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRQVLCTKSNPNSGK 381 VRAGKA LC TKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGR+VLCTKSNPNSGK Sbjct: 92 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGK 151 Query: 382 R 384 R Sbjct: 152 R 152 >ref|XP_016683329.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Gossypium hirsutum] Length = 153 Score = 118 bits (296), Expect = 3e-31 Identities = 58/61 (95%), Positives = 59/61 (96%) Frame = +1 Query: 202 VRAGKAVLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRQVLCTKSNPNSGK 381 VRAGKA LC TKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGR+VLCTKSNPNSGK Sbjct: 93 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGK 152 Query: 382 R 384 R Sbjct: 153 R 153 >ref|XP_012450509.1| PREDICTED: 50S ribosomal protein L34, chloroplastic [Gossypium raimondii] gb|KJB63242.1| hypothetical protein B456_010G1587002 [Gossypium raimondii] Length = 153 Score = 118 bits (296), Expect = 3e-31 Identities = 58/61 (95%), Positives = 59/61 (96%) Frame = +1 Query: 202 VRAGKAVLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRQVLCTKSNPNSGK 381 VRAGKA LC TKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGR+VLCTKSNPNSGK Sbjct: 93 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGK 152 Query: 382 R 384 R Sbjct: 153 R 153 >ref|XP_016687506.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Gossypium hirsutum] gb|PPD91110.1| hypothetical protein GOBAR_DD11953 [Gossypium barbadense] Length = 157 Score = 118 bits (296), Expect = 3e-31 Identities = 58/61 (95%), Positives = 59/61 (96%) Frame = +1 Query: 202 VRAGKAVLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRQVLCTKSNPNSGK 381 VRAGKA LC TKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGR+VLCTKSNPNSGK Sbjct: 97 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGK 156 Query: 382 R 384 R Sbjct: 157 R 157 >ref|XP_012445398.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Gossypium raimondii] gb|KJB57430.1| hypothetical protein B456_009G163700 [Gossypium raimondii] Length = 157 Score = 118 bits (296), Expect = 3e-31 Identities = 58/61 (95%), Positives = 59/61 (96%) Frame = +1 Query: 202 VRAGKAVLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRQVLCTKSNPNSGK 381 VRAGKA LC TKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGR+VLCTKSNPNSGK Sbjct: 97 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGK 156 Query: 382 R 384 R Sbjct: 157 R 157 >ref|XP_008225220.1| PREDICTED: 50S ribosomal protein L34, chloroplastic [Prunus mume] Length = 99 Score = 116 bits (291), Expect = 3e-31 Identities = 55/62 (88%), Positives = 60/62 (96%) Frame = +1 Query: 202 VRAGKAVLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRQVLCTKSNPNSGK 381 VRAGKA LC+TKRNRSRKSLARTHGFRRRMRTT GRA+LKRRRAKGR++LCTK+NPNSGK Sbjct: 38 VRAGKAALCLTKRNRSRKSLARTHGFRRRMRTTGGRAMLKRRRAKGRRILCTKTNPNSGK 97 Query: 382 RA 387 RA Sbjct: 98 RA 99 >ref|XP_002274637.3| PREDICTED: 50S ribosomal protein L34, chloroplastic [Vitis vinifera] Length = 148 Score = 118 bits (295), Expect = 3e-31 Identities = 58/62 (93%), Positives = 60/62 (96%) Frame = +1 Query: 202 VRAGKAVLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRQVLCTKSNPNSGK 381 VRAGKA LC TKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGR+VLCTKSNP+SGK Sbjct: 87 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPSSGK 146 Query: 382 RA 387 RA Sbjct: 147 RA 148 >emb|CAN60201.1| hypothetical protein VITISV_036402 [Vitis vinifera] Length = 148 Score = 118 bits (295), Expect = 3e-31 Identities = 58/62 (93%), Positives = 60/62 (96%) Frame = +1 Query: 202 VRAGKAVLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRQVLCTKSNPNSGK 381 VRAGKA LC TKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGR+VLCTKSNP+SGK Sbjct: 87 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPSSGK 146 Query: 382 RA 387 RA Sbjct: 147 RA 148 >ref|XP_020102270.1| 50S ribosomal protein L34, chloroplastic-like [Ananas comosus] gb|OAY74832.1| 50S ribosomal protein L34, chloroplastic [Ananas comosus] Length = 155 Score = 118 bits (295), Expect = 4e-31 Identities = 58/62 (93%), Positives = 61/62 (98%) Frame = +1 Query: 202 VRAGKAVLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRQVLCTKSNPNSGK 381 VRAGKA LCMTKR+RSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGR+VLCTKSNP+SGK Sbjct: 94 VRAGKAALCMTKRSRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPSSGK 153 Query: 382 RA 387 RA Sbjct: 154 RA 155 >ref|XP_022721086.1| 50S ribosomal protein L34, chloroplastic-like [Durio zibethinus] Length = 156 Score = 118 bits (295), Expect = 4e-31 Identities = 57/61 (93%), Positives = 59/61 (96%) Frame = +1 Query: 202 VRAGKAVLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRQVLCTKSNPNSGK 381 VRAGKA LC TKRNRSRKSLARTHGFRRRMRTTSGRA+LKRRRAKGR+VLCTKSNPNSGK Sbjct: 96 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAILKRRRAKGRKVLCTKSNPNSGK 155 Query: 382 R 384 R Sbjct: 156 R 156 >ref|XP_021599506.1| 50S ribosomal protein L34, chloroplastic-like [Manihot esculenta] gb|OAY24916.1| hypothetical protein MANES_17G054200 [Manihot esculenta] Length = 160 Score = 118 bits (295), Expect = 5e-31 Identities = 57/61 (93%), Positives = 59/61 (96%) Frame = +1 Query: 202 VRAGKAVLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRQVLCTKSNPNSGK 381 VRAGKA LC TKRNRSRKSLARTHGFRRRMRTTSGRA+LKRRRAKGR+VLCTKSNPNSGK Sbjct: 98 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAILKRRRAKGRRVLCTKSNPNSGK 157 Query: 382 R 384 R Sbjct: 158 R 158 >ref|XP_010277750.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Nelumbo nucifera] Length = 150 Score = 117 bits (294), Expect = 5e-31 Identities = 58/62 (93%), Positives = 59/62 (95%) Frame = +1 Query: 202 VRAGKAVLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRQVLCTKSNPNSGK 381 VRAGKA LC TKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGR+VLC KSNPNSGK Sbjct: 89 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCPKSNPNSGK 148 Query: 382 RA 387 RA Sbjct: 149 RA 150 >ref|XP_021293910.1| 50S ribosomal protein L34, chloroplastic [Herrania umbratica] Length = 158 Score = 117 bits (294), Expect = 6e-31 Identities = 57/62 (91%), Positives = 60/62 (96%) Frame = +1 Query: 202 VRAGKAVLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRQVLCTKSNPNSGK 381 VRAGKA LC TKRNRSRKSLARTHGFRRRMRTTSGRAVL+RRRAKGR+VLCTKSNPNSGK Sbjct: 97 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLRRRRAKGRKVLCTKSNPNSGK 156 Query: 382 RA 387 R+ Sbjct: 157 RS 158 >ref|XP_004293930.1| PREDICTED: 50S ribosomal protein L34, chloroplastic [Fragaria vesca subsp. vesca] Length = 150 Score = 117 bits (293), Expect = 7e-31 Identities = 56/62 (90%), Positives = 61/62 (98%) Frame = +1 Query: 202 VRAGKAVLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRQVLCTKSNPNSGK 381 VRAGKA LC+TKRN+SRKSLARTHGFRRRMRTTSGRA+LKRRRAKGR+VLCTK+NPNSGK Sbjct: 89 VRAGKAALCLTKRNKSRKSLARTHGFRRRMRTTSGRAMLKRRRAKGRKVLCTKTNPNSGK 148 Query: 382 RA 387 RA Sbjct: 149 RA 150 >ref|XP_017631621.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Gossypium arboreum] Length = 152 Score = 117 bits (293), Expect = 7e-31 Identities = 57/61 (93%), Positives = 59/61 (96%) Frame = +1 Query: 202 VRAGKAVLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRQVLCTKSNPNSGK 381 VRAGKA LC TKRNRSRKSLARTHGFRRRMRTTSGRA+LKRRRAKGR+VLCTKSNPNSGK Sbjct: 92 VRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRALLKRRRAKGRKVLCTKSNPNSGK 151 Query: 382 R 384 R Sbjct: 152 R 152 >gb|OMO65329.1| Ribosomal protein L34 [Corchorus olitorius] Length = 81 Score = 115 bits (287), Expect = 8e-31 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = +1 Query: 202 VRAGKAVLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRQVLCTKSNPNSGK 381 VRAGKA LC+TKRNRSRKSLARTHGFRRRMRTT GRA+LKRRRAKGR+VLC KSNPNSGK Sbjct: 19 VRAGKAALCLTKRNRSRKSLARTHGFRRRMRTTGGRAILKRRRAKGRKVLCPKSNPNSGK 78 Query: 382 R 384 R Sbjct: 79 R 79