BLASTX nr result
ID: Ophiopogon26_contig00000226
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00000226 (370 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020108721.1| uncharacterized protein LOC109724339 [Ananas... 55 4e-07 gb|KDO36725.1| hypothetical protein CISIN_1g032157mg [Citrus sin... 55 4e-07 ref|XP_011013112.1| PREDICTED: uncharacterized protein LOC105117... 55 5e-07 gb|OIT38574.1| hypothetical protein A4A49_01138 [Nicotiana atten... 53 9e-07 ref|XP_015877592.1| PREDICTED: uncharacterized protein LOC107414... 55 1e-06 dbj|GAV67781.1| LOW QUALITY PROTEIN: hypothetical protein CFOL_v... 54 1e-06 gb|KDP21633.1| hypothetical protein JCGZ_03304 [Jatropha curcas] 52 2e-06 dbj|BAJ88018.1| predicted protein [Hordeum vulgare subsp. vulgare] 51 2e-06 ref|XP_002520889.1| PREDICTED: uncharacterized protein LOC827662... 54 3e-06 ref|XP_010921168.2| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 54 3e-06 ref|XP_021638469.1| uncharacterized protein LOC110633933 [Hevea ... 53 4e-06 ref|XP_011470002.1| PREDICTED: uncharacterized protein LOC105353... 53 4e-06 ref|XP_021626116.1| uncharacterized protein LOC110624943 [Maniho... 52 5e-06 ref|XP_007220421.1| uncharacterized protein LOC18786944 [Prunus ... 53 5e-06 ref|XP_017178208.1| PREDICTED: uncharacterized protein LOC108169... 52 7e-06 ref|XP_008234167.1| PREDICTED: uncharacterized protein LOC103333... 52 8e-06 ref|XP_021828496.1| uncharacterized protein LOC110768926 [Prunus... 52 8e-06 gb|ONK62674.1| uncharacterized protein A4U43_C07F6790 [Asparagus... 52 1e-05 >ref|XP_020108721.1| uncharacterized protein LOC109724339 [Ananas comosus] Length = 125 Score = 55.1 bits (131), Expect = 4e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 368 DDGRDPTDYDRRARIFYESSRVFQALKERSS 276 D+GR+PTDYDRRA IF ESSRVF+ALKERS+ Sbjct: 94 DEGREPTDYDRRAHIFSESSRVFRALKERSA 124 >gb|KDO36725.1| hypothetical protein CISIN_1g032157mg [Citrus sinensis] Length = 146 Score = 55.5 bits (132), Expect = 4e-07 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = -3 Query: 368 DDGRDPTDYDRRARIFYESSRVFQALKERS 279 D+G++PTDY+RRA+IFY+SSRVFQALKERS Sbjct: 108 DEGKEPTDYNRRAQIFYKSSRVFQALKERS 137 >ref|XP_011013112.1| PREDICTED: uncharacterized protein LOC105117224 [Populus euphratica] Length = 155 Score = 55.5 bits (132), Expect = 5e-07 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -3 Query: 368 DDGRDPTDYDRRARIFYESSRVFQALKERSSVDVSDS 258 D+GRDPTDY+RRA+IFY+SS+VF ALKERS++ S Sbjct: 119 DEGRDPTDYNRRAQIFYKSSQVFTALKERSTLSQCQS 155 >gb|OIT38574.1| hypothetical protein A4A49_01138 [Nicotiana attenuata] Length = 81 Score = 53.1 bits (126), Expect = 9e-07 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = -3 Query: 368 DDGRDPTDYDRRARIFYESSRVFQALKERSSVDVS 264 D+G++P DY+RRA+IFY SSRVFQALKER + S Sbjct: 45 DEGKEPMDYNRRAQIFYNSSRVFQALKEREATSTS 79 >ref|XP_015877592.1| PREDICTED: uncharacterized protein LOC107414023 [Ziziphus jujuba] Length = 174 Score = 55.1 bits (131), Expect = 1e-06 Identities = 27/40 (67%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = -3 Query: 368 DDGRDPTDYDRRARIFYESSRVFQALKERSSVDVS-DSDN 252 D GR+P DY+RRA+IF +SSRVFQALKER++VDV D D+ Sbjct: 130 DQGREPNDYNRRAQIFDKSSRVFQALKERTNVDVDVDGDS 169 >dbj|GAV67781.1| LOW QUALITY PROTEIN: hypothetical protein CFOL_v3_11285, partial [Cephalotus follicularis] Length = 114 Score = 53.5 bits (127), Expect = 1e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 368 DDGRDPTDYDRRARIFYESSRVFQALKERSSVDV 267 D+G+DPTDY+RRA IF +SSRVFQALKER+S V Sbjct: 35 DEGKDPTDYNRRAHIFDKSSRVFQALKERTSSPV 68 >gb|KDP21633.1| hypothetical protein JCGZ_03304 [Jatropha curcas] Length = 82 Score = 52.0 bits (123), Expect = 2e-06 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = -3 Query: 368 DDGRDPTDYDRRARIFYESSRVFQALKERSS 276 D+GRDP+DY+RRA+IF +SSRVFQALKER++ Sbjct: 45 DEGRDPSDYNRRAQIFDKSSRVFQALKERTT 75 >dbj|BAJ88018.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 53 Score = 51.2 bits (121), Expect = 2e-06 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -3 Query: 368 DDGRDPTDYDRRARIFYESSRVFQALKERSSVD 270 D+GR PTDY RRA IF ESSRVF+ALKER D Sbjct: 5 DEGRSPTDYGRRAHIFQESSRVFRALKERRDED 37 >ref|XP_002520889.1| PREDICTED: uncharacterized protein LOC8276627 [Ricinus communis] gb|EEF41598.1| conserved hypothetical protein [Ricinus communis] Length = 150 Score = 53.5 bits (127), Expect = 3e-06 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = -3 Query: 368 DDGRDPTDYDRRARIFYESSRVFQALKERSS 276 D+GRDPTDY+RRA+IF +SSRVFQALKER++ Sbjct: 115 DEGRDPTDYNRRAQIFDKSSRVFQALKERTA 145 >ref|XP_010921168.2| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105044837 [Elaeis guineensis] Length = 173 Score = 53.9 bits (128), Expect = 3e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -3 Query: 368 DDGRDPTDYDRRARIFYESSRVFQALKERSSVDVSD 261 D+GR PTDYDRRA IF ESSRVFQALK+R+ +D Sbjct: 130 DEGRAPTDYDRRAHIFSESSRVFQALKDRNGQPTTD 165 >ref|XP_021638469.1| uncharacterized protein LOC110633933 [Hevea brasiliensis] Length = 138 Score = 52.8 bits (125), Expect = 4e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 368 DDGRDPTDYDRRARIFYESSRVFQALKERSS 276 D+GRDP DY+RRARIF +SS+VFQALKERS+ Sbjct: 105 DEGRDPIDYNRRARIFDKSSKVFQALKERST 135 >ref|XP_011470002.1| PREDICTED: uncharacterized protein LOC105353083 [Fragaria vesca subsp. vesca] Length = 159 Score = 53.1 bits (126), Expect = 4e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = -3 Query: 368 DDGRDPTDYDRRARIFYESSRVFQALKERSS 276 D+G+DP DY+RRA+IFY+SSRVFQALKE +S Sbjct: 127 DEGKDPNDYNRRAQIFYKSSRVFQALKESTS 157 >ref|XP_021626116.1| uncharacterized protein LOC110624943 [Manihot esculenta] gb|OAY38288.1| hypothetical protein MANES_10G003000 [Manihot esculenta] Length = 129 Score = 52.4 bits (124), Expect = 5e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 368 DDGRDPTDYDRRARIFYESSRVFQALKERSS 276 D+GRDP DY+RRA+IF +SSRVFQALKERS+ Sbjct: 96 DEGRDPIDYNRRAQIFDKSSRVFQALKERST 126 >ref|XP_007220421.1| uncharacterized protein LOC18786944 [Prunus persica] gb|ONI24839.1| hypothetical protein PRUPE_2G265400 [Prunus persica] Length = 157 Score = 52.8 bits (125), Expect = 5e-06 Identities = 22/30 (73%), Positives = 30/30 (100%) Frame = -3 Query: 368 DDGRDPTDYDRRARIFYESSRVFQALKERS 279 D+G++P+DY+RRA+IFY+SSRVFQALKER+ Sbjct: 126 DEGKEPSDYNRRAQIFYKSSRVFQALKERN 155 >ref|XP_017178208.1| PREDICTED: uncharacterized protein LOC108169406 [Malus domestica] Length = 149 Score = 52.4 bits (124), Expect = 7e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -3 Query: 368 DDGRDPTDYDRRARIFYESSRVFQALKERS 279 D+G++P DY RRA+IFY+SSRVFQALKERS Sbjct: 118 DEGKEPKDYHRRAQIFYKSSRVFQALKERS 147 >ref|XP_008234167.1| PREDICTED: uncharacterized protein LOC103333150 [Prunus mume] Length = 156 Score = 52.4 bits (124), Expect = 8e-06 Identities = 22/30 (73%), Positives = 29/30 (96%) Frame = -3 Query: 368 DDGRDPTDYDRRARIFYESSRVFQALKERS 279 D+G++P DY+RRA+IFY+SSRVFQALKER+ Sbjct: 125 DEGKEPNDYNRRAQIFYKSSRVFQALKERN 154 >ref|XP_021828496.1| uncharacterized protein LOC110768926 [Prunus avium] Length = 157 Score = 52.4 bits (124), Expect = 8e-06 Identities = 22/30 (73%), Positives = 29/30 (96%) Frame = -3 Query: 368 DDGRDPTDYDRRARIFYESSRVFQALKERS 279 D+G++P DY+RRA+IFY+SSRVFQALKER+ Sbjct: 126 DEGKEPNDYNRRAQIFYKSSRVFQALKERN 155 >gb|ONK62674.1| uncharacterized protein A4U43_C07F6790 [Asparagus officinalis] Length = 132 Score = 51.6 bits (122), Expect = 1e-05 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -3 Query: 368 DDGRDPTDYDRRARIFYESSRVFQALKERSSVD 270 D+GR+P DYDRRA IF ESSRVFQ LKER+ D Sbjct: 90 DEGREPLDYDRRAHIFDESSRVFQELKERNGRD 122