BLASTX nr result
ID: Ophiopogon26_contig00000163
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00000163 (378 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK76485.1| uncharacterized protein A4U43_C03F28570 [Asparagu... 74 9e-13 ref|XP_020258475.1| flowering locus K homology domain-like [Aspa... 74 1e-12 ref|XP_010905450.1| PREDICTED: flowering locus K homology domain... 55 4e-06 ref|XP_008775276.1| PREDICTED: flowering locus K homology domain... 54 8e-06 >gb|ONK76485.1| uncharacterized protein A4U43_C03F28570 [Asparagus officinalis] Length = 368 Score = 73.6 bits (179), Expect = 9e-13 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +3 Query: 3 LIQNFMAEAGAPAQNTAPPVDHGYSSYQASYGSTYGAPTV 122 LIQNFMAEAGAP+QN APPVDHGY+SYQ SYGS+Y AP V Sbjct: 307 LIQNFMAEAGAPSQNPAPPVDHGYNSYQPSYGSSYSAPPV 346 >ref|XP_020258475.1| flowering locus K homology domain-like [Asparagus officinalis] Length = 489 Score = 73.6 bits (179), Expect = 1e-12 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +3 Query: 3 LIQNFMAEAGAPAQNTAPPVDHGYSSYQASYGSTYGAPTV 122 LIQNFMAEAGAP+QN APPVDHGY+SYQ SYGS+Y AP V Sbjct: 428 LIQNFMAEAGAPSQNPAPPVDHGYNSYQPSYGSSYSAPPV 467 >ref|XP_010905450.1| PREDICTED: flowering locus K homology domain [Elaeis guineensis] Length = 440 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +3 Query: 3 LIQNFMAEAGAPAQNTAPPVDHGYSSYQASYGSTYGAPTV 122 LI+NFMAEA APAQNT PVD GY+SY A +GS Y +P V Sbjct: 380 LIKNFMAEAAAPAQNTVAPVDQGYNSYSA-HGSMYTSPPV 418 >ref|XP_008775276.1| PREDICTED: flowering locus K homology domain [Phoenix dactylifera] ref|XP_008775277.1| PREDICTED: flowering locus K homology domain [Phoenix dactylifera] ref|XP_008775278.1| PREDICTED: flowering locus K homology domain [Phoenix dactylifera] Length = 440 Score = 53.9 bits (128), Expect = 8e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +3 Query: 3 LIQNFMAEAGAPAQNTAPPVDHGYSSYQASYGSTYGAPTV 122 LI+NFMAEA APAQNT PVD GY+SY A +GS Y +P V Sbjct: 380 LIKNFMAEAAAPAQNTMAPVDQGYNSYPA-HGSMYTSPPV 418