BLASTX nr result
ID: Ophiopogon25_contig00056038
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00056038 (358 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020253166.1| FHA domain-containing protein PS1 [Asparagus... 56 1e-06 gb|ONK77489.1| uncharacterized protein A4U43_C02F7090 [Asparagus... 56 1e-06 >ref|XP_020253166.1| FHA domain-containing protein PS1 [Asparagus officinalis] Length = 806 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 176 NQENNVTLEVYNREETLFRVLFDNEKENEMEEIFVSAEENM 54 N+E + LE +EETLFR LF+NEKENE EE FVSAEEN+ Sbjct: 255 NKEKSAALEESKKEETLFRALFENEKENEEEENFVSAEENI 295 >gb|ONK77489.1| uncharacterized protein A4U43_C02F7090 [Asparagus officinalis] Length = 937 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 176 NQENNVTLEVYNREETLFRVLFDNEKENEMEEIFVSAEENM 54 N+E + LE +EETLFR LF+NEKENE EE FVSAEEN+ Sbjct: 255 NKEKSAALEESKKEETLFRALFENEKENEEEENFVSAEENI 295