BLASTX nr result
ID: Ophiopogon25_contig00055713
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00055713 (489 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020248224.1| B3 domain-containing protein Os01g0905400-li... 72 1e-11 >ref|XP_020248224.1| B3 domain-containing protein Os01g0905400-like [Asparagus officinalis] gb|ONK57191.1| uncharacterized protein A4U43_C10F17540 [Asparagus officinalis] Length = 639 Score = 72.4 bits (176), Expect = 1e-11 Identities = 40/82 (48%), Positives = 49/82 (59%) Frame = -2 Query: 311 NQGKKIEESGRNLPIVLSDDDEETDEVIMIKDYSYVDKSNGGTKSSANEHVENRKGNLAV 132 N E++GRN PIVLSDDD+ +++ D SN K SA ++ENRK NL V Sbjct: 170 NHNASDEDAGRNSPIVLSDDDKVMEKLTK-------DGSNRWVKKSAENNIENRKKNLIV 222 Query: 131 DKRSANRCFLTTERKSSMERKE 66 DKR+ RC TERKSS RKE Sbjct: 223 DKRTTRRCLYATERKSSNVRKE 244