BLASTX nr result
ID: Ophiopogon25_contig00055403
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00055403 (447 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY55205.1| hypothetical protein RhiirA4_474519 [Rhizophagus ... 54 1e-10 >gb|PKY55205.1| hypothetical protein RhiirA4_474519 [Rhizophagus irregularis] Length = 261 Score = 53.5 bits (127), Expect(2) = 1e-10 Identities = 36/88 (40%), Positives = 50/88 (56%), Gaps = 8/88 (9%) Frame = -1 Query: 426 HFCLIINVEESTKIFVNQKV-PNVLPLETYIKKLHLMCMSKRY*NV--WSGRYQKWIPIE 256 +F LI++VEE K + KV N + E KK+ L +R + W+ KWIPIE Sbjct: 2 NFRLIVSVEEGIKTLIVPKVLNNCITFEDLYKKVTLNIYEQRDVKIYGWTDAKSKWIPIE 61 Query: 255 E*FDDELEVII-NLKFTE----IAPSSP 187 + FDDE ++I+ +LKFTE I PS P Sbjct: 62 KCFDDEFKIIVTSLKFTEIKFKITPSLP 89 Score = 40.0 bits (92), Expect(2) = 1e-10 Identities = 21/28 (75%), Positives = 23/28 (82%), Gaps = 2/28 (7%) Frame = -3 Query: 127 LGMLYNELIILFQAKNVG--*GLHVDIE 50 L MLYNELIILF+ KNVG GLH+DIE Sbjct: 123 LDMLYNELIILFREKNVGWKGGLHIDIE 150