BLASTX nr result
ID: Ophiopogon25_contig00055381
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00055381 (393 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK72110.1| hypothetical protein RhiirC2_743433 [Rhizophagus ... 78 4e-16 gb|POG76959.1| hypothetical protein GLOIN_2v1768430 [Rhizophagus... 64 2e-10 dbj|GBC22267.1| Tis13_27006: PROVISIONAL [Rhizophagus irregulari... 64 3e-10 gb|POG63406.1| hypothetical protein GLOIN_2v555430 [Rhizophagus ... 58 3e-08 gb|PKC68833.1| hypothetical protein RhiirA1_416435, partial [Rhi... 57 3e-08 gb|PKY55194.1| hypothetical protein RhiirA4_410357, partial [Rhi... 56 6e-08 gb|PKC07533.1| hypothetical protein RhiirA5_359070 [Rhizophagus ... 55 9e-08 gb|PKB97819.1| hypothetical protein RhiirA5_114800 [Rhizophagus ... 57 1e-07 gb|PKK70162.1| hypothetical protein RhiirC2_476516 [Rhizophagus ... 57 1e-07 gb|EXX72000.1| hypothetical protein RirG_073430 [Rhizophagus irr... 58 3e-07 gb|PKC03139.1| hypothetical protein RhiirA5_503620 [Rhizophagus ... 58 5e-07 gb|EXX72403.1| hypothetical protein RirG_069690 [Rhizophagus irr... 57 5e-07 gb|EXX72401.1| hypothetical protein RirG_069690 [Rhizophagus irr... 57 5e-07 gb|EXX72400.1| hypothetical protein RirG_069690 [Rhizophagus irr... 57 5e-07 gb|PKC75804.1| hypothetical protein RhiirA1_528464 [Rhizophagus ... 57 6e-07 gb|POG57762.1| hypothetical protein GLOIN_2v1737129 [Rhizophagus... 57 6e-07 gb|EXX66513.1| hypothetical protein RirG_123070 [Rhizophagus irr... 57 6e-07 >gb|PKK72110.1| hypothetical protein RhiirC2_743433 [Rhizophagus irregularis] Length = 99 Score = 77.8 bits (190), Expect = 4e-16 Identities = 36/67 (53%), Positives = 49/67 (73%) Frame = +1 Query: 187 QEADINWILSSRDPTPIAFFRLTHPTARTRAFEKYRKCFNLALDRSEGDRFDKLRVVNNS 366 QEA+INWILSS + PI FFRLTH T+ +A E +RK F+LA+ RSEGD+ + R +N+ Sbjct: 15 QEANINWILSSSELKPIGFFRLTHLTSCAQAIENFRKYFDLAIKRSEGDKLSEFRAINSD 74 Query: 367 EETLQRD 387 E ++Q D Sbjct: 75 EVSIQYD 81 >gb|POG76959.1| hypothetical protein GLOIN_2v1768430 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 136 Score = 64.3 bits (155), Expect = 2e-10 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = +1 Query: 259 PTARTRAFEKYRKCFNLALDRSEGDRFDKLRVVNNSEETLQRDRE 393 P++ AFEKY+KCFNLALD E D+ DKLR VNN E TLQRD E Sbjct: 17 PSSGGHAFEKYKKCFNLALDHCEDDKLDKLRAVNNDEVTLQRDWE 61 >dbj|GBC22267.1| Tis13_27006: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 162 Score = 64.3 bits (155), Expect = 3e-10 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = +1 Query: 259 PTARTRAFEKYRKCFNLALDRSEGDRFDKLRVVNNSEETLQRDRE 393 P++ AFEKY+KCFNLALD E D+ DKLR VNN E TLQRD E Sbjct: 17 PSSGGHAFEKYKKCFNLALDHCEDDKLDKLRAVNNDEVTLQRDWE 61 >gb|POG63406.1| hypothetical protein GLOIN_2v555430 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 119 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 4/69 (5%) Frame = +1 Query: 187 QEADINWILSSRDPTPIAFFRLTHPTARTRAFEKYRKCFNLALDRSEGD----RFDKLRV 354 QE + W+L+ DPTP+AFFR PT R +A EKY+K NLAL ++ + +F++++ Sbjct: 18 QERHVYWMLTCPDPTPLAFFRFIFPTHRIKASEKYKKALNLALKETDAEDLRNKFEEMKK 77 Query: 355 VNNSEETLQ 381 + N L+ Sbjct: 78 LVNEARILE 86 >gb|PKC68833.1| hypothetical protein RhiirA1_416435, partial [Rhizophagus irregularis] gb|PKY18979.1| hypothetical protein RhiirB3_406277, partial [Rhizophagus irregularis] Length = 64 Score = 56.6 bits (135), Expect = 3e-08 Identities = 25/49 (51%), Positives = 32/49 (65%) Frame = +1 Query: 187 QEADINWILSSRDPTPIAFFRLTHPTARTRAFEKYRKCFNLALDRSEGD 333 QE INW+L+S+DP P++FFR P R RA +KYR NLAL+ D Sbjct: 15 QEGHINWMLNSQDPNPLSFFRHICPAHRVRAIDKYRNVLNLALENHTND 63 >gb|PKY55194.1| hypothetical protein RhiirA4_410357, partial [Rhizophagus irregularis] Length = 63 Score = 55.8 bits (133), Expect = 6e-08 Identities = 24/46 (52%), Positives = 32/46 (69%) Frame = +1 Query: 187 QEADINWILSSRDPTPIAFFRLTHPTARTRAFEKYRKCFNLALDRS 324 QE INW+L+S+DP P++FFR P R RA +KYR NLAL+ + Sbjct: 15 QEGHINWMLNSKDPNPLSFFRHICPAHRVRAIDKYRNVLNLALENT 60 >gb|PKC07533.1| hypothetical protein RhiirA5_359070 [Rhizophagus irregularis] Length = 63 Score = 55.5 bits (132), Expect = 9e-08 Identities = 24/46 (52%), Positives = 32/46 (69%) Frame = +1 Query: 187 QEADINWILSSRDPTPIAFFRLTHPTARTRAFEKYRKCFNLALDRS 324 QE INW+L+S+DP P++FFR P R RA +KYR NLAL+ + Sbjct: 15 QEGHINWMLNSQDPNPLSFFRHICPANRVRAIDKYRNVLNLALENT 60 >gb|PKB97819.1| hypothetical protein RhiirA5_114800 [Rhizophagus irregularis] Length = 128 Score = 57.0 bits (136), Expect = 1e-07 Identities = 27/61 (44%), Positives = 40/61 (65%), Gaps = 1/61 (1%) Frame = +1 Query: 187 QEADINWILSSRDPTPIAFFRLTHPTARTRAFEKYRKCFNLALDRSEGDRF-DKLRVVNN 363 QEA+INW+L+ +PTPIAFFR P R +A +KYR NLAL+ ++ +KL+ + Sbjct: 25 QEANINWMLACPNPTPIAFFRYIFPAHRVKATDKYRSTLNLALNTTDNQELRNKLKTMKE 84 Query: 364 S 366 + Sbjct: 85 T 85 >gb|PKK70162.1| hypothetical protein RhiirC2_476516 [Rhizophagus irregularis] Length = 124 Score = 56.6 bits (135), Expect = 1e-07 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 4/69 (5%) Frame = +1 Query: 187 QEADINWILSSRDPTPIAFFRLTHPTARTRAFEKYRKCFNLALDRSEGD----RFDKLRV 354 QE + W+L+ DPTP+AFFR PT R +A EKY K NLAL ++ + +F++++ Sbjct: 18 QERHVYWMLTCPDPTPLAFFRFIFPTHRIKASEKYTKALNLALKETDDEDLRNKFEEMKK 77 Query: 355 VNNSEETLQ 381 + N L+ Sbjct: 78 LVNEARILE 86 >gb|EXX72000.1| hypothetical protein RirG_073430 [Rhizophagus irregularis DAOM 197198w] Length = 575 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 4/69 (5%) Frame = +1 Query: 187 QEADINWILSSRDPTPIAFFRLTHPTARTRAFEKYRKCFNLALDRSEGD----RFDKLRV 354 QE + W+L+ DPTP+AFFR PT R +A EKY+K NLAL ++ + +F++++ Sbjct: 18 QERHVYWMLTCPDPTPLAFFRFIFPTHRIKASEKYKKALNLALKETDAEDLRNKFEEMKK 77 Query: 355 VNNSEETLQ 381 + N L+ Sbjct: 78 LVNEARILE 86 >gb|PKC03139.1| hypothetical protein RhiirA5_503620 [Rhizophagus irregularis] Length = 583 Score = 57.8 bits (138), Expect = 5e-07 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 4/69 (5%) Frame = +1 Query: 187 QEADINWILSSRDPTPIAFFRLTHPTARTRAFEKYRKCFNLALDRSEGD----RFDKLRV 354 QE + W+L+ DPTP+AFFR PT R +A EKY+K NLAL ++ + +F++++ Sbjct: 26 QERHVYWMLTCPDPTPLAFFRFIFPTHRIKASEKYKKALNLALKETDDEDLRNKFEEMKK 85 Query: 355 VNNSEETLQ 381 + N L+ Sbjct: 86 LVNEARILE 94 >gb|EXX72403.1| hypothetical protein RirG_069690 [Rhizophagus irregularis DAOM 197198w] Length = 292 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/61 (44%), Positives = 40/61 (65%), Gaps = 1/61 (1%) Frame = +1 Query: 187 QEADINWILSSRDPTPIAFFRLTHPTARTRAFEKYRKCFNLALDRSEGDRF-DKLRVVNN 363 QEA+INW+L+ +PTPIAFFR P R +A +KYR NLAL+ ++ +KL+ + Sbjct: 25 QEANINWMLACSNPTPIAFFRYIFPAHRVKATDKYRSTLNLALNTTDNQELRNKLKTMKE 84 Query: 364 S 366 + Sbjct: 85 T 85 >gb|EXX72401.1| hypothetical protein RirG_069690 [Rhizophagus irregularis DAOM 197198w] gb|EXX72402.1| hypothetical protein RirG_069690 [Rhizophagus irregularis DAOM 197198w] Length = 309 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/61 (44%), Positives = 40/61 (65%), Gaps = 1/61 (1%) Frame = +1 Query: 187 QEADINWILSSRDPTPIAFFRLTHPTARTRAFEKYRKCFNLALDRSEGDRF-DKLRVVNN 363 QEA+INW+L+ +PTPIAFFR P R +A +KYR NLAL+ ++ +KL+ + Sbjct: 11 QEANINWMLACSNPTPIAFFRYIFPAHRVKATDKYRSTLNLALNTTDNQELRNKLKTMKE 70 Query: 364 S 366 + Sbjct: 71 T 71 >gb|EXX72400.1| hypothetical protein RirG_069690 [Rhizophagus irregularis DAOM 197198w] Length = 323 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/61 (44%), Positives = 40/61 (65%), Gaps = 1/61 (1%) Frame = +1 Query: 187 QEADINWILSSRDPTPIAFFRLTHPTARTRAFEKYRKCFNLALDRSEGDRF-DKLRVVNN 363 QEA+INW+L+ +PTPIAFFR P R +A +KYR NLAL+ ++ +KL+ + Sbjct: 25 QEANINWMLACSNPTPIAFFRYIFPAHRVKATDKYRSTLNLALNTTDNQELRNKLKTMKE 84 Query: 364 S 366 + Sbjct: 85 T 85 >gb|PKC75804.1| hypothetical protein RhiirA1_528464 [Rhizophagus irregularis] gb|PKY14275.1| hypothetical protein RhiirB3_519479 [Rhizophagus irregularis] Length = 583 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/69 (40%), Positives = 42/69 (60%), Gaps = 4/69 (5%) Frame = +1 Query: 187 QEADINWILSSRDPTPIAFFRLTHPTARTRAFEKYRKCFNLAL----DRSEGDRFDKLRV 354 QE + W+L+ DPTP+AFFR PT R +A EKY+K NLAL D ++F++++ Sbjct: 26 QERHVYWMLTCPDPTPLAFFRFIFPTHRIKASEKYKKALNLALKETNDEDLRNKFEEMKK 85 Query: 355 VNNSEETLQ 381 + N L+ Sbjct: 86 LVNEARILE 94 >gb|POG57762.1| hypothetical protein GLOIN_2v1737129 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 602 Score = 57.4 bits (137), Expect = 6e-07 Identities = 27/61 (44%), Positives = 40/61 (65%), Gaps = 1/61 (1%) Frame = +1 Query: 187 QEADINWILSSRDPTPIAFFRLTHPTARTRAFEKYRKCFNLALDRSEGDRF-DKLRVVNN 363 QEA+INW+L+ +PTPIAFFR P R +A +KYR NLAL+ ++ +KL+ + Sbjct: 11 QEANINWMLACSNPTPIAFFRYIFPAHRVKATDKYRSTLNLALNTTDNQELRNKLKTMKE 70 Query: 364 S 366 + Sbjct: 71 T 71 >gb|EXX66513.1| hypothetical protein RirG_123070 [Rhizophagus irregularis DAOM 197198w] Length = 616 Score = 57.4 bits (137), Expect = 6e-07 Identities = 27/61 (44%), Positives = 40/61 (65%), Gaps = 1/61 (1%) Frame = +1 Query: 187 QEADINWILSSRDPTPIAFFRLTHPTARTRAFEKYRKCFNLALDRSEGDRF-DKLRVVNN 363 QEA+INW+L+ +PTPIAFFR P R +A +KYR NLAL+ ++ +KL+ + Sbjct: 25 QEANINWMLACSNPTPIAFFRYIFPAHRVKATDKYRSTLNLALNTTDNQELRNKLKTMKE 84 Query: 364 S 366 + Sbjct: 85 T 85