BLASTX nr result
ID: Ophiopogon25_contig00055380
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00055380 (462 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020256884.1| E3 ubiquitin-protein ligase BRE1-like 2 [Asp... 57 2e-06 >ref|XP_020256884.1| E3 ubiquitin-protein ligase BRE1-like 2 [Asparagus officinalis] gb|ONK75057.1| uncharacterized protein A4U43_C03F12870 [Asparagus officinalis] Length = 862 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +3 Query: 12 KKSKMHSFEKNFKDLKGKQNSYDQTLITMNRI*NQVI 122 +KSKMH EK KDLK KQ+SYDQTL+TMNRI NQ++ Sbjct: 38 QKSKMHDLEKKLKDLKDKQDSYDQTLMTMNRIWNQLV 74