BLASTX nr result
ID: Ophiopogon25_contig00055312
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00055312 (472 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX52599.1| hypothetical protein RirG_251510 [Rhizophagus irr... 55 5e-06 dbj|GBC28283.1| spry domain containing protein [Rhizophagus irre... 55 6e-06 >gb|EXX52599.1| hypothetical protein RirG_251510 [Rhizophagus irregularis DAOM 197198w] gb|POG78085.1| hypothetical protein GLOIN_2v1541884 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 313 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/64 (43%), Positives = 35/64 (54%) Frame = +1 Query: 79 MYQTFANYRLSGLAERMRIFGSXXXXXXXXXXXXXXXXXMEEVLRPPPPTYNKALEGIGL 258 ++ TFA+YRL GL E R +G M+ LRPPPP Y+ AL+G GL Sbjct: 103 VHPTFASYRLGGLTEIFRRYGGNNGIPNVNDDEINGE--MDAALRPPPPAYSTALQGAGL 160 Query: 259 PPPY 270 PPPY Sbjct: 161 PPPY 164 >dbj|GBC28283.1| spry domain containing protein [Rhizophagus irregularis DAOM 181602] Length = 680 Score = 55.5 bits (132), Expect = 6e-06 Identities = 28/64 (43%), Positives = 35/64 (54%) Frame = +1 Query: 79 MYQTFANYRLSGLAERMRIFGSXXXXXXXXXXXXXXXXXMEEVLRPPPPTYNKALEGIGL 258 ++ TFA+YRL GL E R +G M+ LRPPPP Y+ AL+G GL Sbjct: 103 VHPTFASYRLGGLTEIFRRYGGNNGIPNVNDDEINGE--MDAALRPPPPAYSTALQGAGL 160 Query: 259 PPPY 270 PPPY Sbjct: 161 PPPY 164