BLASTX nr result
ID: Ophiopogon25_contig00055309
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00055309 (511 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264805.1| premnaspirodiene oxygenase-like [Asparagus o... 57 2e-06 >ref|XP_020264805.1| premnaspirodiene oxygenase-like [Asparagus officinalis] gb|ONK69708.1| uncharacterized protein A4U43_C05F25900 [Asparagus officinalis] Length = 507 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 194 AELIQNPRVMKKAMDEVR*VVGGKPKITKSDTEEL 90 +ELIQNPRVMKKA DEVR VVG KPKIT+SD +EL Sbjct: 320 SELIQNPRVMKKAQDEVRRVVGSKPKITESDIKEL 354