BLASTX nr result
ID: Ophiopogon25_contig00055274
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00055274 (457 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC08922.1| hypothetical protein RhiirA5_167358 [Rhizophagus ... 65 4e-10 dbj|GBC31477.1| hypothetical protein RIR_1679600 [Rhizophagus ir... 65 5e-10 dbj|GBC31478.1| hypothetical protein RIR_1679600 [Rhizophagus ir... 65 5e-10 >gb|PKC08922.1| hypothetical protein RhiirA5_167358 [Rhizophagus irregularis] gb|PKC74974.1| hypothetical protein RhiirA1_150611 [Rhizophagus irregularis] Length = 180 Score = 65.1 bits (157), Expect = 4e-10 Identities = 30/56 (53%), Positives = 41/56 (73%), Gaps = 1/56 (1%) Frame = +3 Query: 291 VTGGILVKKLAEVGKGIARYNVIFLPECNKNDPIRATFVE-EWQTFEKFFNKAEEE 455 V + KKL+E+G+GIARY+VIFLPEC+KND +R+ F + EW+ FE F K + E Sbjct: 11 VANSVTAKKLSEIGEGIARYSVIFLPECHKNDILRSKFSDYEWRNFENIFCKKDIE 66 >dbj|GBC31477.1| hypothetical protein RIR_1679600 [Rhizophagus irregularis DAOM 181602] Length = 197 Score = 65.1 bits (157), Expect = 5e-10 Identities = 30/56 (53%), Positives = 41/56 (73%), Gaps = 1/56 (1%) Frame = +3 Query: 291 VTGGILVKKLAEVGKGIARYNVIFLPECNKNDPIRATFVE-EWQTFEKFFNKAEEE 455 V + KKL+E+G+GIARY+VIFLPEC+KND +R+ F + EW+ FE F K + E Sbjct: 105 VANSVTAKKLSEIGEGIARYSVIFLPECHKNDILRSKFSDYEWRNFENIFCKKDIE 160 >dbj|GBC31478.1| hypothetical protein RIR_1679600 [Rhizophagus irregularis DAOM 181602] Length = 199 Score = 65.1 bits (157), Expect = 5e-10 Identities = 30/56 (53%), Positives = 41/56 (73%), Gaps = 1/56 (1%) Frame = +3 Query: 291 VTGGILVKKLAEVGKGIARYNVIFLPECNKNDPIRATFVE-EWQTFEKFFNKAEEE 455 V + KKL+E+G+GIARY+VIFLPEC+KND +R+ F + EW+ FE F K + E Sbjct: 107 VANSVTAKKLSEIGEGIARYSVIFLPECHKNDILRSKFSDYEWRNFENIFCKKDIE 162