BLASTX nr result
ID: Ophiopogon25_contig00055199
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00055199 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK60829.1| hypothetical protein RhiirC2_856656 [Rhizophagus ... 56 2e-06 gb|PKC03343.1| hypothetical protein RhiirA5_451583 [Rhizophagus ... 56 2e-06 >gb|PKK60829.1| hypothetical protein RhiirC2_856656 [Rhizophagus irregularis] Length = 303 Score = 56.2 bits (134), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +3 Query: 333 TRLQGEQHEKYIKFFHRGDSNNFIIQQKRD 422 T +QGEQHEKYI+FFHRGD NNFI QQ+RD Sbjct: 236 TEVQGEQHEKYIEFFHRGDPNNFIKQQERD 265 >gb|PKC03343.1| hypothetical protein RhiirA5_451583 [Rhizophagus irregularis] gb|PKC57994.1| hypothetical protein RhiirA1_496797 [Rhizophagus irregularis] gb|PKY30368.1| hypothetical protein RhiirB3_486188 [Rhizophagus irregularis] Length = 417 Score = 56.2 bits (134), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +3 Query: 333 TRLQGEQHEKYIKFFHRGDSNNFIIQQKRD 422 T +QGEQHEKYI+FFHRGD NNFI QQ+RD Sbjct: 350 TEVQGEQHEKYIEFFHRGDPNNFIKQQERD 379