BLASTX nr result
ID: Ophiopogon25_contig00055079
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00055079 (378 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC11995.1| cyclin-domain-containing protein, partial [Rhizop... 74 8e-14 gb|EXX53648.1| Pho80p [Rhizophagus irregularis DAOM 197198w] >gi... 74 8e-14 >gb|PKC11995.1| cyclin-domain-containing protein, partial [Rhizophagus irregularis] gb|PKC57506.1| cyclin-domain-containing protein, partial [Rhizophagus irregularis] Length = 202 Score = 74.3 bits (181), Expect = 8e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 104 MNHTPQTVIEVPQYFDEVDIDHLMYMIADMLGRL 3 MNHTPQTVIEVPQYFDEVDIDHLMYMIADMLGRL Sbjct: 1 MNHTPQTVIEVPQYFDEVDIDHLMYMIADMLGRL 34 >gb|EXX53648.1| Pho80p [Rhizophagus irregularis DAOM 197198w] dbj|GBC12882.1| cyclin-dependent protein kinase regulator pho80 [Rhizophagus irregularis DAOM 181602] gb|PKK68041.1| cyclin-domain-containing protein [Rhizophagus irregularis] gb|PKY30668.1| cyclin-domain-containing protein [Rhizophagus irregularis] gb|PKY58042.1| cyclin-domain-containing protein [Rhizophagus irregularis] gb|POG62059.1| cyclin-domain-containing protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 203 Score = 74.3 bits (181), Expect = 8e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 104 MNHTPQTVIEVPQYFDEVDIDHLMYMIADMLGRL 3 MNHTPQTVIEVPQYFDEVDIDHLMYMIADMLGRL Sbjct: 1 MNHTPQTVIEVPQYFDEVDIDHLMYMIADMLGRL 34