BLASTX nr result
ID: Ophiopogon25_contig00054989
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00054989 (421 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX70918.1| hypothetical protein RirG_083110 [Rhizophagus irr... 103 6e-24 >gb|EXX70918.1| hypothetical protein RirG_083110 [Rhizophagus irregularis DAOM 197198w] dbj|GBC45783.1| umta methyltransferase family protein [Rhizophagus irregularis DAOM 181602] Length = 286 Score = 103 bits (256), Expect = 6e-24 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -3 Query: 419 GAELVVSLILRTLITTKSIRKKDYEDIAKKMVIEVNKVESYFCKHRIWAKKVG 261 GAELV+SLILRTLIT KSIRKKDYEDIAKKM+IEVNKVESYFCKHRIWAKKVG Sbjct: 234 GAELVISLILRTLITKKSIRKKDYEDIAKKMMIEVNKVESYFCKHRIWAKKVG 286