BLASTX nr result
ID: Ophiopogon25_contig00054987
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00054987 (388 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX62895.1| hypothetical protein RirG_157480 [Rhizophagus irr... 61 1e-09 dbj|GBC33837.1| tkl protein kinase [Rhizophagus irregularis DAOM... 63 3e-09 gb|ANQ32828.1| MATA-HMG [Rhizophagus irregularis] 59 2e-08 gb|PKY40175.1| hypothetical protein RhiirA4_394367 [Rhizophagus ... 59 2e-08 gb|ANQ32827.1| MATA-HMG [Rhizophagus irregularis] >gi|1042419431... 55 4e-07 gb|PKC12756.1| hypothetical protein RhiirA5_352565 [Rhizophagus ... 55 5e-07 gb|EXX75317.1| hypothetical protein RirG_042860 [Rhizophagus irr... 55 5e-07 >gb|EXX62895.1| hypothetical protein RirG_157480 [Rhizophagus irregularis DAOM 197198w] Length = 91 Score = 60.8 bits (146), Expect = 1e-09 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -1 Query: 388 YKYACVLRAQNQGLNLPPRIISLMVPILWCNESADIKSTYLTIAQQ 251 Y+ AC+LRA+NQGLNLP IS + ILW NES DIK+T+L IA+Q Sbjct: 45 YRKACLLRAKNQGLNLPLSTISSIASILWRNESVDIKNTFLDIAKQ 90 >dbj|GBC33837.1| tkl protein kinase [Rhizophagus irregularis DAOM 181602] gb|POG77098.1| hypothetical protein GLOIN_2v821828 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 214 Score = 62.8 bits (151), Expect = 3e-09 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = -1 Query: 388 YKYACVLRAQNQGLNLPPRIISLMVPILWCNESADIKSTYLTIAQQANTHI 236 Y+ AC+LRA+NQGLNLP IS + ILW NES DIK+T+L IA+Q THI Sbjct: 141 YRKACLLRAKNQGLNLPLSTISSIASILWRNESVDIKNTFLDIAKQV-THI 190 >gb|ANQ32828.1| MATA-HMG [Rhizophagus irregularis] Length = 134 Score = 58.9 bits (141), Expect = 2e-08 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = -1 Query: 388 YKYACVLRAQNQGLNLPPRIISLMVPILWCNESADIKSTYLTIAQQA 248 Y+ AC+LRAQ+QGLNL P ISLM LW NESA IK Y+ IA +A Sbjct: 67 YRRACILRAQDQGLNLSPSEISLMASNLWGNESAAIKQVYINIAVEA 113 >gb|PKY40175.1| hypothetical protein RhiirA4_394367 [Rhizophagus irregularis] Length = 139 Score = 58.9 bits (141), Expect = 2e-08 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = -1 Query: 388 YKYACVLRAQNQGLNLPPRIISLMVPILWCNESADIKSTYLTIAQQA 248 Y+ AC+LRAQ+QGLNL P ISLM LW NESA IK Y+ IA +A Sbjct: 67 YRRACILRAQDQGLNLSPSEISLMASNLWGNESAAIKQVYINIAVEA 113 >gb|ANQ32827.1| MATA-HMG [Rhizophagus irregularis] gb|ANQ32829.1| MATA-HMG [Rhizophagus irregularis] gb|ANQ32830.1| MATA-HMG [Rhizophagus irregularis] gb|ANQ32831.1| MATA-HMG [Rhizophagus irregularis] Length = 133 Score = 55.5 bits (132), Expect = 4e-07 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = -1 Query: 388 YKYACVLRAQNQGLNLPPRIISLMVPILWCNESADIKSTYLTIAQQA 248 Y+ AC+LRAQ+QGL L P ISLM LW NESA IK Y+ IA +A Sbjct: 66 YRRACILRAQDQGLTLLPSEISLMASNLWRNESAAIKQVYIDIAVEA 112 >gb|PKC12756.1| hypothetical protein RhiirA5_352565 [Rhizophagus irregularis] Length = 138 Score = 55.5 bits (132), Expect = 5e-07 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = -1 Query: 388 YKYACVLRAQNQGLNLPPRIISLMVPILWCNESADIKSTYLTIAQQA 248 Y+ AC+LRAQ+QGL L P ISLM LW NESA IK Y+ IA +A Sbjct: 66 YRRACILRAQDQGLTLLPSEISLMASNLWRNESAAIKQVYIDIAVEA 112 >gb|EXX75317.1| hypothetical protein RirG_042860 [Rhizophagus irregularis DAOM 197198w] dbj|GBC14031.1| hypothetical protein RIR_0264200 [Rhizophagus irregularis DAOM 181602] gb|PKC60457.1| hypothetical protein RhiirA1_425910 [Rhizophagus irregularis] gb|PKK67395.1| hypothetical protein RhiirC2_852188 [Rhizophagus irregularis] gb|PKY16272.1| hypothetical protein RhiirB3_402681 [Rhizophagus irregularis] gb|POG61322.1| hypothetical protein GLOIN_2v1786750 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 138 Score = 55.5 bits (132), Expect = 5e-07 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = -1 Query: 388 YKYACVLRAQNQGLNLPPRIISLMVPILWCNESADIKSTYLTIAQQA 248 Y+ AC+LRAQ+QGL L P ISLM LW NESA IK Y+ IA +A Sbjct: 66 YRRACILRAQDQGLTLLPSEISLMASNLWRNESAAIKQVYIDIAVEA 112