BLASTX nr result
ID: Ophiopogon25_contig00054878
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00054878 (444 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY27508.1| hypothetical protein RhiirB3_390352 [Rhizophagus ... 70 1e-12 >gb|PKY27508.1| hypothetical protein RhiirB3_390352 [Rhizophagus irregularis] Length = 122 Score = 70.1 bits (170), Expect = 1e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 130 SSERGLVEPQSSAMIMTDEDGASMSPKANRKVQVFY 237 SSERGLVEPQSSAMI+TDEDGASMSPK NRKVQVFY Sbjct: 87 SSERGLVEPQSSAMIITDEDGASMSPKVNRKVQVFY 122