BLASTX nr result
ID: Ophiopogon25_contig00054846
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00054846 (473 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK60582.1| hypothetical protein RhiirC2_761640 [Rhizophagus ... 86 2e-19 >gb|PKK60582.1| hypothetical protein RhiirC2_761640 [Rhizophagus irregularis] Length = 61 Score = 85.9 bits (211), Expect = 2e-19 Identities = 40/44 (90%), Positives = 40/44 (90%) Frame = -2 Query: 274 YYSWAFEKNYRSNIKSNN*KALKQRLMMMVDFEKKNQSHFTSKK 143 YYSWAFEKNYRSNIK NN K LKQRLMMMVDFEKKNQSHF SKK Sbjct: 12 YYSWAFEKNYRSNIKGNNRKVLKQRLMMMVDFEKKNQSHFNSKK 55