BLASTX nr result
ID: Ophiopogon25_contig00054839
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00054839 (475 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC26418.1| Tis13_95161 [Rhizophagus irregularis DAOM 181602... 57 1e-07 gb|PKK60568.1| hypothetical protein RhiirC2_793135 [Rhizophagus ... 59 3e-07 gb|PKY60524.1| hypothetical protein RhiirA4_518983 [Rhizophagus ... 59 3e-07 >dbj|GBC26418.1| Tis13_95161 [Rhizophagus irregularis DAOM 181602] gb|PKY33183.1| hypothetical protein RhiirB3_451908 [Rhizophagus irregularis] Length = 113 Score = 57.0 bits (136), Expect = 1e-07 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -1 Query: 196 SIDVDADKDRVIIGRVKTFSLSTITSLSWDDIKYVIVKML 77 SI+VD + R +IGR+KTFSLSTIT+LS +DIKYVIVK+L Sbjct: 72 SINVDVNMGRAMIGRIKTFSLSTITALSKEDIKYVIVKVL 111 >gb|PKK60568.1| hypothetical protein RhiirC2_793135 [Rhizophagus irregularis] Length = 288 Score = 58.9 bits (141), Expect = 3e-07 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -1 Query: 196 SIDVDADKDRVIIGRVKTFSLSTITSLSWDDIKYVIVKMLR 74 SI+VD + R +IGR+KTFSLSTIT+LS +DIKYVIVK+LR Sbjct: 247 SINVDVNMGRAMIGRIKTFSLSTITALSKEDIKYVIVKVLR 287 >gb|PKY60524.1| hypothetical protein RhiirA4_518983 [Rhizophagus irregularis] Length = 322 Score = 58.9 bits (141), Expect = 3e-07 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -1 Query: 196 SIDVDADKDRVIIGRVKTFSLSTITSLSWDDIKYVIVKMLR 74 SI+VD + R +IGR+KTFSLSTIT+LS +DIKYVIVK+LR Sbjct: 281 SINVDVNMGRAMIGRIKTFSLSTITALSKEDIKYVIVKVLR 321