BLASTX nr result
ID: Ophiopogon25_contig00054828
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00054828 (820 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY17551.1| RNA-binding domain-containing protein [Rhizophagu... 86 3e-17 gb|PKY41172.1| RNA-binding domain-containing protein [Rhizophagu... 86 4e-17 gb|PKC14366.1| RNA-binding domain-containing protein [Rhizophagu... 86 4e-17 dbj|GBC26269.1| glycine-rich RNA-binding protein 2 [Rhizophagus ... 86 1e-15 gb|KEQ65147.1| hypothetical protein M437DRAFT_12863, partial [Au... 75 1e-13 gb|KEQ82274.1| RNA-binding domain-containing protein, partial [A... 74 2e-13 ref|XP_002840273.1| hypothetical protein [Tuber melanosporum Mel... 74 3e-13 dbj|GAO85437.1| glycine-rich RNA-binding protein 4, mitochondria... 74 6e-13 ref|XP_018078384.1| RNA-binding domain-containing protein [Phial... 75 6e-13 gb|OSS49532.1| hypothetical protein B5807_06016 [Epicoccum nigrum] 74 1e-12 gb|OBW68002.1| Uncharacterized protein AUREO_019430 [Aureobasidi... 74 1e-12 ref|XP_001818346.1| unnamed protein product [Aspergillus oryzae ... 73 1e-12 ref|XP_002373568.1| glycine-rich RNA-binding protein, putative [... 73 1e-12 ref|XP_022583125.1| hypothetical protein ASPZODRAFT_130704 [Peni... 73 1e-12 ref|XP_013347216.1| hypothetical protein AUEXF2481DRAFT_1867 [Au... 74 1e-12 ref|XP_007777322.1| hypothetical protein W97_01224 [Coniosporium... 74 1e-12 ref|XP_018288262.1| hypothetical protein PHYBLDRAFT_95547, parti... 72 1e-12 ref|XP_013430569.1| hypothetical protein M436DRAFT_17457, partia... 71 2e-12 gb|EIT79731.1| glycine-rich RNA-binding protein, putative [Asper... 73 3e-12 gb|OQD85119.1| hypothetical protein PENANT_c011G01166 [Penicilli... 72 3e-12 >gb|PKY17551.1| RNA-binding domain-containing protein [Rhizophagus irregularis] Length = 128 Score = 85.5 bits (210), Expect = 3e-17 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -3 Query: 818 IRDRDTGRSRGFGFVTYSSNEEAEVAIQNMNEQEFDGRTIKVDRASE 678 IRDRDTGRSRGFGFVT++SNEEAE+AIQN+N+ EFDGR IKVDRA+E Sbjct: 35 IRDRDTGRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAE 81 >gb|PKY41172.1| RNA-binding domain-containing protein [Rhizophagus irregularis] Length = 133 Score = 85.5 bits (210), Expect = 4e-17 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -3 Query: 818 IRDRDTGRSRGFGFVTYSSNEEAEVAIQNMNEQEFDGRTIKVDRASE 678 IRDRDTGRSRGFGFVT++SNEEAE+AIQN+N+ EFDGR IKVDRA+E Sbjct: 35 IRDRDTGRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAE 81 >gb|PKC14366.1| RNA-binding domain-containing protein [Rhizophagus irregularis] gb|PKC70041.1| RNA-binding domain-containing protein [Rhizophagus irregularis] gb|PKK73911.1| RNA-binding domain-containing protein [Rhizophagus irregularis] gb|POG68613.1| hypothetical protein GLOIN_2v1635358 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 134 Score = 85.5 bits (210), Expect = 4e-17 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -3 Query: 818 IRDRDTGRSRGFGFVTYSSNEEAEVAIQNMNEQEFDGRTIKVDRASE 678 IRDRDTGRSRGFGFVT++SNEEAE+AIQN+N+ EFDGR IKVDRA+E Sbjct: 35 IRDRDTGRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAE 81 >dbj|GBC26269.1| glycine-rich RNA-binding protein 2 [Rhizophagus irregularis DAOM 181602] Length = 319 Score = 85.5 bits (210), Expect = 1e-15 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -3 Query: 818 IRDRDTGRSRGFGFVTYSSNEEAEVAIQNMNEQEFDGRTIKVDRASE 678 IRDRDTGRSRGFGFVT++SNEEAE+AIQN+N+ EFDGR IKVDRA+E Sbjct: 220 IRDRDTGRSRGFGFVTFASNEEAEIAIQNLNDAEFDGRNIKVDRAAE 266 >gb|KEQ65147.1| hypothetical protein M437DRAFT_12863, partial [Aureobasidium melanogenum CBS 110374] Length = 79 Score = 74.7 bits (182), Expect = 1e-13 Identities = 34/47 (72%), Positives = 42/47 (89%) Frame = -3 Query: 818 IRDRDTGRSRGFGFVTYSSNEEAEVAIQNMNEQEFDGRTIKVDRASE 678 ++DRDTGRSRGFGFV +S+ EEA+ AI+ MNE EFDGRTI+VD+ASE Sbjct: 27 VKDRDTGRSRGFGFVRFSNEEEADAAIKAMNEIEFDGRTIRVDKASE 73 >gb|KEQ82274.1| RNA-binding domain-containing protein, partial [Aureobasidium pullulans EXF-150] Length = 89 Score = 74.3 bits (181), Expect = 2e-13 Identities = 33/47 (70%), Positives = 42/47 (89%) Frame = -3 Query: 818 IRDRDTGRSRGFGFVTYSSNEEAEVAIQNMNEQEFDGRTIKVDRASE 678 ++DRDTGRSRGFGFV +S+ +EA+ AI+ MNE EFDGRTI+VD+ASE Sbjct: 26 VKDRDTGRSRGFGFVRFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 72 >ref|XP_002840273.1| hypothetical protein [Tuber melanosporum Mel28] emb|CAZ84464.1| unnamed protein product [Tuber melanosporum] Length = 91 Score = 73.9 bits (180), Expect = 3e-13 Identities = 33/47 (70%), Positives = 41/47 (87%) Frame = -3 Query: 818 IRDRDTGRSRGFGFVTYSSNEEAEVAIQNMNEQEFDGRTIKVDRASE 678 ++DRDTGRSRGFGFV YSS+EEA A+ NMN+ EFDGR I+VD+AS+ Sbjct: 34 VKDRDTGRSRGFGFVRYSSDEEATAAMDNMNDVEFDGRRIRVDKASD 80 >dbj|GAO85437.1| glycine-rich RNA-binding protein 4, mitochondrial [Aspergillus udagawae] Length = 129 Score = 74.3 bits (181), Expect = 6e-13 Identities = 32/47 (68%), Positives = 42/47 (89%) Frame = -3 Query: 818 IRDRDTGRSRGFGFVTYSSNEEAEVAIQNMNEQEFDGRTIKVDRASE 678 ++DRDT RSRGFGFV +S++ EA+ A++NMN QEFDGRTI+VD+ASE Sbjct: 34 VKDRDTNRSRGFGFVRFSNDSEADTAMENMNNQEFDGRTIRVDKASE 80 >ref|XP_018078384.1| RNA-binding domain-containing protein [Phialocephala scopiformis] gb|KUJ24029.1| RNA-binding domain-containing protein [Phialocephala scopiformis] Length = 164 Score = 75.1 bits (183), Expect = 6e-13 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = -3 Query: 818 IRDRDTGRSRGFGFVTYSSNEEAEVAIQNMNEQEFDGRTIKVDRASE 678 ++DRDTGRSRGFGFV Y+S +EAE AI +MN EFDGRTI+VD+ASE Sbjct: 34 VKDRDTGRSRGFGFVRYTSEQEAEAAINSMNNIEFDGRTIRVDKASE 80 >gb|OSS49532.1| hypothetical protein B5807_06016 [Epicoccum nigrum] Length = 158 Score = 74.3 bits (181), Expect = 1e-12 Identities = 33/47 (70%), Positives = 42/47 (89%) Frame = -3 Query: 818 IRDRDTGRSRGFGFVTYSSNEEAEVAIQNMNEQEFDGRTIKVDRASE 678 ++DRDTGRSRGFGFV ++S+ EA+ A+QNMN EFDGRTI+VD+ASE Sbjct: 34 VKDRDTGRSRGFGFVRFASDAEADTAMQNMNNIEFDGRTIRVDKASE 80 >gb|OBW68002.1| Uncharacterized protein AUREO_019430 [Aureobasidium pullulans] Length = 168 Score = 74.3 bits (181), Expect = 1e-12 Identities = 33/47 (70%), Positives = 42/47 (89%) Frame = -3 Query: 818 IRDRDTGRSRGFGFVTYSSNEEAEVAIQNMNEQEFDGRTIKVDRASE 678 ++DRDTGRSRGFGFV +S+ +EA+ AI+ MNE EFDGRTI+VD+ASE Sbjct: 34 VKDRDTGRSRGFGFVRFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 80 >ref|XP_001818346.1| unnamed protein product [Aspergillus oryzae RIB40] dbj|BAE56344.1| unnamed protein product [Aspergillus oryzae RIB40] Length = 127 Score = 73.2 bits (178), Expect = 1e-12 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = -3 Query: 818 IRDRDTGRSRGFGFVTYSSNEEAEVAIQNMNEQEFDGRTIKVDRASE 678 ++DRDTGRSRGFGFV +SS +AE A MN QEFDGRTI+VD+ASE Sbjct: 34 VKDRDTGRSRGFGFVRFSSEADAEAAAHEMNNQEFDGRTIRVDKASE 80 >ref|XP_002373568.1| glycine-rich RNA-binding protein, putative [Aspergillus flavus NRRL3357] gb|EED57956.1| glycine-rich RNA-binding protein, putative [Aspergillus flavus NRRL3357] gb|KOC16550.1| glycine-rich RNA-binding protein [Aspergillus flavus AF70] gb|OOO12460.1| RNP-1 like RNA-binding protein [Aspergillus oryzae] Length = 127 Score = 73.2 bits (178), Expect = 1e-12 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = -3 Query: 818 IRDRDTGRSRGFGFVTYSSNEEAEVAIQNMNEQEFDGRTIKVDRASE 678 ++DRDTGRSRGFGFV +SS +AE A MN QEFDGRTI+VD+ASE Sbjct: 34 VKDRDTGRSRGFGFVRFSSEADAEAAAHEMNNQEFDGRTIRVDKASE 80 >ref|XP_022583125.1| hypothetical protein ASPZODRAFT_130704 [Penicilliopsis zonata CBS 506.65] gb|OJJ48615.1| hypothetical protein ASPZODRAFT_130704 [Penicilliopsis zonata CBS 506.65] Length = 129 Score = 73.2 bits (178), Expect = 1e-12 Identities = 32/47 (68%), Positives = 42/47 (89%) Frame = -3 Query: 818 IRDRDTGRSRGFGFVTYSSNEEAEVAIQNMNEQEFDGRTIKVDRASE 678 ++DRDT RSRGFGFV ++++EEA+ A+Q MN QEFDGRTI+VD+ASE Sbjct: 34 VKDRDTNRSRGFGFVRFATDEEADAAMQAMNNQEFDGRTIRVDKASE 80 >ref|XP_013347216.1| hypothetical protein AUEXF2481DRAFT_1867 [Aureobasidium subglaciale EXF-2481] gb|KEQ99049.1| hypothetical protein AUEXF2481DRAFT_1867 [Aureobasidium subglaciale EXF-2481] Length = 172 Score = 74.3 bits (181), Expect = 1e-12 Identities = 33/47 (70%), Positives = 42/47 (89%) Frame = -3 Query: 818 IRDRDTGRSRGFGFVTYSSNEEAEVAIQNMNEQEFDGRTIKVDRASE 678 ++DRDTGRSRGFGFV +S+ +EA+ AI+ MNE EFDGRTI+VD+ASE Sbjct: 34 VKDRDTGRSRGFGFVRFSNEDEADAAIKGMNEIEFDGRTIRVDKASE 80 >ref|XP_007777322.1| hypothetical protein W97_01224 [Coniosporium apollinis CBS 100218] gb|EON62005.1| hypothetical protein W97_01224 [Coniosporium apollinis CBS 100218] Length = 172 Score = 74.3 bits (181), Expect = 1e-12 Identities = 33/47 (70%), Positives = 42/47 (89%) Frame = -3 Query: 818 IRDRDTGRSRGFGFVTYSSNEEAEVAIQNMNEQEFDGRTIKVDRASE 678 ++DRDTGRSRGFGFV +S++ EA+ AIQ+MN EFDGRTI+VD+ASE Sbjct: 34 VKDRDTGRSRGFGFVRFSNDSEADAAIQSMNNVEFDGRTIRVDKASE 80 >ref|XP_018288262.1| hypothetical protein PHYBLDRAFT_95547, partial [Phycomyces blakesleeanus NRRL 1555(-)] gb|OAD70222.1| hypothetical protein PHYBLDRAFT_95547, partial [Phycomyces blakesleeanus NRRL 1555(-)] Length = 78 Score = 71.6 bits (174), Expect = 1e-12 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -3 Query: 818 IRDRDTGRSRGFGFVTYSSNEEAEVAIQNMNEQEFDGRTIKVDRAS 681 +RDRDTGRSRGFGFVTYSS+ EA+ AI +NEQE DGR IKV+ AS Sbjct: 31 MRDRDTGRSRGFGFVTYSSDSEAQAAIDALNEQELDGRRIKVNMAS 76 >ref|XP_013430569.1| hypothetical protein M436DRAFT_17457, partial [Aureobasidium namibiae CBS 147.97] gb|KEQ77214.1| hypothetical protein M436DRAFT_17457, partial [Aureobasidium namibiae CBS 147.97] Length = 79 Score = 71.2 bits (173), Expect = 2e-12 Identities = 33/47 (70%), Positives = 41/47 (87%) Frame = -3 Query: 818 IRDRDTGRSRGFGFVTYSSNEEAEVAIQNMNEQEFDGRTIKVDRASE 678 ++DRDTGRSRGFGFV +S+ EA+ AI+ MNE EFDGRTI+VD+ASE Sbjct: 27 VKDRDTGRSRGFGFVRFSNEGEADEAIKAMNEIEFDGRTIRVDKASE 73 >gb|EIT79731.1| glycine-rich RNA-binding protein, putative [Aspergillus oryzae 3.042] gb|KDE79915.1| glycine-rich RNA-binding protein, putative [Aspergillus oryzae 100-8] Length = 153 Score = 73.2 bits (178), Expect = 3e-12 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = -3 Query: 818 IRDRDTGRSRGFGFVTYSSNEEAEVAIQNMNEQEFDGRTIKVDRASE 678 ++DRDTGRSRGFGFV +SS +AE A MN QEFDGRTI+VD+ASE Sbjct: 60 VKDRDTGRSRGFGFVRFSSEADAEAAAHEMNNQEFDGRTIRVDKASE 106 >gb|OQD85119.1| hypothetical protein PENANT_c011G01166 [Penicillium antarcticum] Length = 130 Score = 72.4 bits (176), Expect = 3e-12 Identities = 32/47 (68%), Positives = 41/47 (87%) Frame = -3 Query: 818 IRDRDTGRSRGFGFVTYSSNEEAEVAIQNMNEQEFDGRTIKVDRASE 678 ++DRDTGRSRGFGFV YSS++EA A+ MN+QEFDGR I+VD+A+E Sbjct: 34 VKDRDTGRSRGFGFVRYSSDDEATAAMNAMNDQEFDGRRIRVDKATE 80