BLASTX nr result
ID: Ophiopogon25_contig00054774
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00054774 (399 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK74195.1| hypothetical protein RhiirC2_739274 [Rhizophagus ... 60 2e-09 gb|POG62651.1| hypothetical protein GLOIN_2v1882740 [Rhizophagus... 60 6e-09 gb|PKC74419.1| hypothetical protein RhiirA1_529629 [Rhizophagus ... 60 6e-09 >gb|PKK74195.1| hypothetical protein RhiirC2_739274 [Rhizophagus irregularis] gb|PKY38416.1| hypothetical protein RhiirA4_391968 [Rhizophagus irregularis] Length = 84 Score = 60.1 bits (144), Expect = 2e-09 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 6/50 (12%) Frame = -2 Query: 398 FNDYVALRDKLRANDYVGKYKL-----MNHSF-FNKL*FYWLTGHFIVLV 267 FNDYVALRDKLRANDYVGKY+L + SF FNKL FYWL +IV++ Sbjct: 25 FNDYVALRDKLRANDYVGKYELILEFSLIESFVFNKLWFYWLIVLYIVVL 74 >gb|POG62651.1| hypothetical protein GLOIN_2v1882740 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 124 Score = 60.1 bits (144), Expect = 6e-09 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 6/50 (12%) Frame = -2 Query: 398 FNDYVALRDKLRANDYVGKYKL-----MNHSF-FNKL*FYWLTGHFIVLV 267 FNDYVALRDKLRANDYVGKY+L + SF FNKL FYWL +IV++ Sbjct: 65 FNDYVALRDKLRANDYVGKYELILEFSLIESFVFNKLWFYWLIVLYIVVL 114 >gb|PKC74419.1| hypothetical protein RhiirA1_529629 [Rhizophagus irregularis] gb|PKY23041.1| hypothetical protein RhiirB3_437140 [Rhizophagus irregularis] Length = 124 Score = 60.1 bits (144), Expect = 6e-09 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 6/50 (12%) Frame = -2 Query: 398 FNDYVALRDKLRANDYVGKYKL-----MNHSF-FNKL*FYWLTGHFIVLV 267 FNDYVALRDKLRANDYVGKY+L + SF FNKL FYWL +IV++ Sbjct: 65 FNDYVALRDKLRANDYVGKYELILEFSLIESFVFNKLWFYWLIVLYIVVL 114