BLASTX nr result
ID: Ophiopogon25_contig00054771
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00054771 (428 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021821585.1| uncharacterized protein LOC110763133 [Prunus... 53 3e-06 ref|XP_007212680.1| uncharacterized protein LOC18778561 [Prunus ... 53 3e-06 gb|OMO76765.1| hypothetical protein CCACVL1_15428 [Corchorus cap... 52 5e-06 gb|OMO64882.1| hypothetical protein COLO4_31758 [Corchorus olito... 52 5e-06 >ref|XP_021821585.1| uncharacterized protein LOC110763133 [Prunus avium] Length = 111 Score = 53.1 bits (126), Expect = 3e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +1 Query: 1 PYSYSKLDKEDPEFVSHRKAKFLIYKPIQDAE 96 PY+YSK+DKEDPE V HR+A+FLIYK +Q AE Sbjct: 8 PYAYSKIDKEDPEEVIHRRAQFLIYKVLQQAE 39 >ref|XP_007212680.1| uncharacterized protein LOC18778561 [Prunus persica] gb|ONI09985.1| hypothetical protein PRUPE_4G022200 [Prunus persica] Length = 111 Score = 53.1 bits (126), Expect = 3e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +1 Query: 1 PYSYSKLDKEDPEFVSHRKAKFLIYKPIQDAE 96 PY+YSK+DKEDPE V HR+A+FLIYK +Q AE Sbjct: 8 PYAYSKMDKEDPEEVIHRRAQFLIYKVLQQAE 39 >gb|OMO76765.1| hypothetical protein CCACVL1_15428 [Corchorus capsularis] Length = 110 Score = 52.4 bits (124), Expect = 5e-06 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = +1 Query: 1 PYSYSKLDKEDPEFVSHRKAKFLIYKPIQDAE 96 PYSYSK+DKEDPE + HR+A+FLIYK +Q A+ Sbjct: 7 PYSYSKIDKEDPEDIIHRRAQFLIYKVMQQAD 38 >gb|OMO64882.1| hypothetical protein COLO4_31758 [Corchorus olitorius] Length = 110 Score = 52.4 bits (124), Expect = 5e-06 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = +1 Query: 1 PYSYSKLDKEDPEFVSHRKAKFLIYKPIQDAE 96 PYSYSK+DKEDPE + HR+A+FLIYK +Q A+ Sbjct: 7 PYSYSKIDKEDPEDIIHRRAQFLIYKVMQQAD 38