BLASTX nr result
ID: Ophiopogon25_contig00054492
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00054492 (379 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK68859.1| uncharacterized protein A4U43_C05F16790 [Asparagu... 77 1e-13 >gb|ONK68859.1| uncharacterized protein A4U43_C05F16790 [Asparagus officinalis] Length = 729 Score = 76.6 bits (187), Expect = 1e-13 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -3 Query: 296 MKVDPGSHPATEFTKAYLSDSRYCPLGPGSDKEVREGTPNI 174 M+ DPGS PATEFTK+ LSDS YCPLGPGSD+EVREGTPNI Sbjct: 1 MRADPGSRPATEFTKSCLSDSMYCPLGPGSDEEVREGTPNI 41