BLASTX nr result
ID: Ophiopogon25_contig00054257
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00054257 (812 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX76782.1| hypothetical protein RirG_029870 [Rhizophagus irr... 62 3e-08 gb|PKY40487.1| hypothetical protein RhiirA4_538867 [Rhizophagus ... 60 3e-07 gb|PKY25602.1| hypothetical protein RhiirB3_440620 [Rhizophagus ... 57 2e-06 gb|PKB97650.1| hypothetical protein RhiirA5_432718 [Rhizophagus ... 45 3e-06 >gb|EXX76782.1| hypothetical protein RirG_029870 [Rhizophagus irregularis DAOM 197198w] Length = 139 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 738 DI*AGINVDKVNDKKLINSAIWGERKFLRAV 646 DI AGINVDKVNDKKLINSAIWGERKFLRAV Sbjct: 60 DIQAGINVDKVNDKKLINSAIWGERKFLRAV 90 >gb|PKY40487.1| hypothetical protein RhiirA4_538867 [Rhizophagus irregularis] Length = 217 Score = 60.5 bits (145), Expect = 3e-07 Identities = 31/35 (88%), Positives = 31/35 (88%) Frame = -3 Query: 741 SDI*AGINVDKVNDKKLINSAIWGERKFLRAVVHL 637 SDI AGINVDKVN KKLINSAIWGERKFLRAV L Sbjct: 149 SDIQAGINVDKVNYKKLINSAIWGERKFLRAVQRL 183 >gb|PKY25602.1| hypothetical protein RhiirB3_440620 [Rhizophagus irregularis] Length = 171 Score = 57.4 bits (137), Expect = 2e-06 Identities = 53/141 (37%), Positives = 68/141 (48%), Gaps = 21/141 (14%) Frame = -2 Query: 625 ISVYPANITDEAIDEAL---TKVIKRNTK*IC*LSIISNLKRSTTYYYHPQYGTIFTSPI 455 ++V ANI D+AIDE L +KVIKRNTK SI ++L T P F+S I Sbjct: 15 LNVASANIIDKAIDEVLIARSKVIKRNTKRARGESI-NSLSFRTCDKLLPSELKNFSSSI 73 Query: 454 CLSQH*TVTN--VLYGLYILKRI----LVFAKQMNGNLYGL*DTN------------HLH 329 + T N LY L+ K+ L+F K+ L + + H Sbjct: 74 WDRFYITYLNQHALYLLHFEKKRKNNNLIFVKKNEWKLAWIYEIQKQLRETQADSSIHAV 133 Query: 328 KTDPGVRTPFTWYSPTKGVDK 266 DPGVR PFTWYSPTKG+ K Sbjct: 134 SIDPGVRAPFTWYSPTKGIGK 154 >gb|PKB97650.1| hypothetical protein RhiirA5_432718 [Rhizophagus irregularis] gb|PKY28215.1| hypothetical protein RhiirB3_444277 [Rhizophagus irregularis] Length = 207 Score = 44.7 bits (104), Expect(2) = 3e-06 Identities = 23/56 (41%), Positives = 33/56 (58%) Frame = -2 Query: 433 VTNVLYGLYILKRILVFAKQMNGNLYGL*DTNHLHKTDPGVRTPFTWYSPTKGVDK 266 ++NV++G Y +R KQ + + H+ DPG+R PFTWYSP+KGV K Sbjct: 1 MSNVIFGHYTSRRD---GKQRRVRKTQVDRSLHVVSIDPGIRFPFTWYSPSKGVGK 53 Score = 35.4 bits (80), Expect(2) = 3e-06 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = -3 Query: 258 ISRIIRLCTYIDKIISQRDKFYRSTS 181 I RI+R C ++DK+ S++DK Y STS Sbjct: 59 IGRIVRTCAFMDKLHSKKDKLYASTS 84