BLASTX nr result
ID: Ophiopogon25_contig00054226
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00054226 (495 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC13103.1| hypothetical protein RhiirA5_372537 [Rhizophagus ... 72 5e-13 gb|PKK75297.1| hypothetical protein RhiirC2_708224 [Rhizophagus ... 71 9e-13 >gb|PKC13103.1| hypothetical protein RhiirA5_372537 [Rhizophagus irregularis] gb|PKY16729.1| hypothetical protein RhiirB3_381973 [Rhizophagus irregularis] Length = 135 Score = 72.0 bits (175), Expect = 5e-13 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +1 Query: 367 LYVIHV*KLRLSNQLKIPHLRPREMTITTPRKPTFSEHSIQYL 495 +++I +LRLSNQLKIPHLRPREMTI TPRKPT SEHSIQYL Sbjct: 88 IWMIEEKRLRLSNQLKIPHLRPREMTIPTPRKPTLSEHSIQYL 130 >gb|PKK75297.1| hypothetical protein RhiirC2_708224 [Rhizophagus irregularis] Length = 114 Score = 70.9 bits (172), Expect = 9e-13 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +1 Query: 388 KLRLSNQLKIPHLRPREMTITTPRKPTFSEHSIQYL 495 +LRLSNQLKIPHLRPREMTI TPRKPT SEHSIQYL Sbjct: 74 RLRLSNQLKIPHLRPREMTIPTPRKPTLSEHSIQYL 109