BLASTX nr result
ID: Ophiopogon25_contig00054219
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00054219 (715 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC55664.1| hypothetical protein RhiirA1_502755 [Rhizophagus ... 55 4e-06 >gb|PKC55664.1| hypothetical protein RhiirA1_502755 [Rhizophagus irregularis] gb|PKY34071.1| hypothetical protein RhiirB3_497395 [Rhizophagus irregularis] Length = 148 Score = 55.5 bits (132), Expect = 4e-06 Identities = 31/58 (53%), Positives = 37/58 (63%), Gaps = 5/58 (8%) Frame = -3 Query: 485 GHRVAPELFSEPFQKAEHCLGCKEE**IHLH----YSHAVMLSTLD-DSIRSERCPEC 327 GHRVAP+LFSEP Q+AE CL CK E I+ H H +S + S+R ERCPEC Sbjct: 15 GHRVAPDLFSEPPQRAEPCLACKRE-IINSHAMFQCGHTFHISCCNASSVRKERCPEC 71