BLASTX nr result
ID: Ophiopogon25_contig00054215
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00054215 (400 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK74706.1| hypothetical protein RhiirC2_846620 [Rhizophagus ... 57 9e-07 gb|EXX70394.1| hypothetical protein RirG_087780 [Rhizophagus irr... 57 9e-07 gb|POG70823.1| hypothetical protein GLOIN_2v1478885 [Rhizophagus... 57 9e-07 >gb|PKK74706.1| hypothetical protein RhiirC2_846620 [Rhizophagus irregularis] Length = 474 Score = 57.0 bits (136), Expect = 9e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -1 Query: 391 TSLEFFRSWSGVKDDIGNFKLSRVNYPNNAIYCSNSN 281 T+ F S++ VKDDIGNFKLSR+NYP+NAIYCSNSN Sbjct: 390 TTKSFIFSFN-VKDDIGNFKLSRINYPSNAIYCSNSN 425 >gb|EXX70394.1| hypothetical protein RirG_087780 [Rhizophagus irregularis DAOM 197198w] Length = 474 Score = 57.0 bits (136), Expect = 9e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -1 Query: 391 TSLEFFRSWSGVKDDIGNFKLSRVNYPNNAIYCSNSN 281 T+ F S++ VKDDIGNFKLSR+NYP+NAIYCSNSN Sbjct: 390 TTKSFIFSFN-VKDDIGNFKLSRINYPSNAIYCSNSN 425 >gb|POG70823.1| hypothetical protein GLOIN_2v1478885 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 478 Score = 57.0 bits (136), Expect = 9e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -1 Query: 391 TSLEFFRSWSGVKDDIGNFKLSRVNYPNNAIYCSNSN 281 T+ F S++ VKDDIGNFKLSR+NYP+NAIYCSNSN Sbjct: 394 TTKSFIFSFN-VKDDIGNFKLSRINYPSNAIYCSNSN 429