BLASTX nr result
ID: Ophiopogon25_contig00054135
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00054135 (780 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY55847.1| DUF1741-domain-containing protein, partial [Rhizo... 57 1e-05 >gb|PKY55847.1| DUF1741-domain-containing protein, partial [Rhizophagus irregularis] Length = 524 Score = 57.4 bits (137), Expect = 1e-05 Identities = 29/57 (50%), Positives = 41/57 (71%) Frame = +1 Query: 100 IDPLSVYYCIAIIMTNYDSLELVTNKRVDQLPPYNEIPYHVSFLRQMLREIVKDFKE 270 I P VY +II +NYD+LEL+T +++D PY+EI +H LRQ+LR IV+DFK+ Sbjct: 469 ITPEQVY---SIISSNYDTLELITPEKLDHYTPYSEIRHHGPLLRQVLRVIVEDFKK 522