BLASTX nr result
ID: Ophiopogon25_contig00053964
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00053964 (521 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX61429.1| hypothetical protein RirG_171170 [Rhizophagus irr... 108 5e-35 gb|POG80378.1| hypothetical protein GLOIN_2v1517824 [Rhizophagus... 107 3e-27 >gb|EXX61429.1| hypothetical protein RirG_171170 [Rhizophagus irregularis DAOM 197198w] dbj|GBC16844.1| DNA-directed RNA polymerase subunit [Rhizophagus irregularis DAOM 181602] Length = 159 Score = 108 bits (269), Expect(2) = 5e-35 Identities = 48/51 (94%), Positives = 48/51 (94%) Frame = -1 Query: 389 RHHHDSQFLPRLFQDPSLKRCISNCKTCNKKTRTIEWHSHRNDSMSV*VAC 237 RHHHDSQFLPRLFQDPSLKRCISNCKTCNKKTRTIEWHSHRNDSMSV C Sbjct: 57 RHHHDSQFLPRLFQDPSLKRCISNCKTCNKKTRTIEWHSHRNDSMSVEYWC 107 Score = 67.4 bits (163), Expect(2) = 5e-35 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 207 HEKSENSYAQLEQEGYCTDEERKELEVVGQEDF 109 +EKSENSYAQLEQEGYCTDEER ELEVVGQEDF Sbjct: 127 NEKSENSYAQLEQEGYCTDEERNELEVVGQEDF 159 >gb|POG80378.1| hypothetical protein GLOIN_2v1517824 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 103 Score = 107 bits (268), Expect = 3e-27 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -1 Query: 389 RHHHDSQFLPRLFQDPSLKRCISNCKTCNKKTRTIEWHSHRNDSMSV 249 RHHHDSQFLPRLFQDPSLKRCISNCKTCNKKTRTIEWHSHRNDSMSV Sbjct: 57 RHHHDSQFLPRLFQDPSLKRCISNCKTCNKKTRTIEWHSHRNDSMSV 103