BLASTX nr result
ID: Ophiopogon25_contig00053930
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00053930 (604 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK70824.1| hypothetical protein RhiirC2_448393 [Rhizophagus ... 87 3e-17 gb|PKC12395.1| hypothetical protein RhiirA5_353043 [Rhizophagus ... 87 1e-16 gb|EXX55000.1| hypothetical protein RirG_229330 [Rhizophagus irr... 87 1e-16 >gb|PKK70824.1| hypothetical protein RhiirC2_448393 [Rhizophagus irregularis] Length = 279 Score = 87.4 bits (215), Expect = 3e-17 Identities = 44/52 (84%), Positives = 46/52 (88%) Frame = -1 Query: 157 MDFINETQDIIRKYRRTEPAVLVSARATTLFILVAILGGYFTILTILIAFDK 2 M+FINE QDIIRKYR+TEP VLVSARAT LFILVAILGGYF ILT LIA DK Sbjct: 1 MEFINEIQDIIRKYRKTEPVVLVSARATALFILVAILGGYFAILTALIALDK 52 >gb|PKC12395.1| hypothetical protein RhiirA5_353043 [Rhizophagus irregularis] Length = 426 Score = 87.4 bits (215), Expect = 1e-16 Identities = 44/52 (84%), Positives = 46/52 (88%) Frame = -1 Query: 157 MDFINETQDIIRKYRRTEPAVLVSARATTLFILVAILGGYFTILTILIAFDK 2 M+FINE QDIIRKYR+TEP VLVSARAT LFILVAILGGYF ILT LIA DK Sbjct: 1 MEFINEIQDIIRKYRKTEPVVLVSARATALFILVAILGGYFAILTALIALDK 52 >gb|EXX55000.1| hypothetical protein RirG_229330 [Rhizophagus irregularis DAOM 197198w] dbj|GBC26561.1| hypothetical protein RIR_1280600 [Rhizophagus irregularis DAOM 181602] gb|POG60857.1| hypothetical protein GLOIN_2v1787334 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 426 Score = 87.4 bits (215), Expect = 1e-16 Identities = 44/52 (84%), Positives = 46/52 (88%) Frame = -1 Query: 157 MDFINETQDIIRKYRRTEPAVLVSARATTLFILVAILGGYFTILTILIAFDK 2 M+FINE QDIIRKYR+TEP VLVSARAT LFILVAILGGYF ILT LIA DK Sbjct: 1 MEFINEIQDIIRKYRKTEPVVLVSARATALFILVAILGGYFAILTALIALDK 52