BLASTX nr result
ID: Ophiopogon25_contig00053899
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00053899 (432 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY52751.1| hypothetical protein RhiirA4_425513 [Rhizophagus ... 43 5e-08 gb|PKK61371.1| hypothetical protein RhiirC2_791891 [Rhizophagus ... 42 1e-07 >gb|PKY52751.1| hypothetical protein RhiirA4_425513 [Rhizophagus irregularis] Length = 122 Score = 42.7 bits (99), Expect(2) = 5e-08 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -2 Query: 401 LRS*IKKEHKPRFVNIPITEFEVRVIDI 318 LRS IKKEH PRF NIPITEF VR I + Sbjct: 35 LRSQIKKEHTPRFDNIPITEFVVRAIPL 62 Score = 42.0 bits (97), Expect(2) = 5e-08 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = -1 Query: 333 PCN*YKVIASVDAEGVLQSVNGGRRDEGRTII 238 P N KV+ASV+AEGV+ SVN GR+DEG+ +I Sbjct: 61 PLNSDKVLASVNAEGVMISVNSGRQDEGQALI 92 >gb|PKK61371.1| hypothetical protein RhiirC2_791891 [Rhizophagus irregularis] gb|PKK61713.1| hypothetical protein RhiirC2_718230 [Rhizophagus irregularis] Length = 122 Score = 42.0 bits (97), Expect(2) = 1e-07 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = -1 Query: 333 PCN*YKVIASVDAEGVLQSVNGGRRDEGRTII 238 P N KV+ASV+AEGV+ SVN GR+DEG+ +I Sbjct: 61 PLNSDKVLASVNAEGVMISVNSGRQDEGQALI 92 Score = 41.2 bits (95), Expect(2) = 1e-07 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -2 Query: 398 RS*IKKEHKPRFVNIPITEFEVRVIDI 318 RS IKKEH PRF NIPITEF VR I + Sbjct: 36 RSQIKKEHTPRFDNIPITEFVVRAIPL 62