BLASTX nr result
ID: Ophiopogon25_contig00053892
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00053892 (477 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC30037.1| hypothetical protein RIR_1564300 [Rhizophagus ir... 88 1e-22 >dbj|GBC30037.1| hypothetical protein RIR_1564300 [Rhizophagus irregularis DAOM 181602] Length = 74 Score = 87.8 bits (216), Expect(2) = 1e-22 Identities = 44/55 (80%), Positives = 46/55 (83%) Frame = -2 Query: 242 AFFFNKYFFADLKPVRESRVHLNSDFYVSLFSISNECIMYLMYHVSFLTF*HLFI 78 + FF + FFADLKPVRESRVHLNSDFYVSLFSISNECIMYLMYHV HLFI Sbjct: 23 SIFFQQIFFADLKPVRESRVHLNSDFYVSLFSISNECIMYLMYHVHSK---HLFI 74 Score = 46.6 bits (109), Expect(2) = 1e-22 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -3 Query: 397 MLSRANKFLKRSSNFEGDCVG 335 MLSRANKFLKRSSNFEGDCVG Sbjct: 1 MLSRANKFLKRSSNFEGDCVG 21