BLASTX nr result
ID: Ophiopogon25_contig00053768
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00053768 (423 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY56606.1| His-Me finger endonuclease [Rhizophagus irregularis] 54 9e-12 >gb|PKY56606.1| His-Me finger endonuclease [Rhizophagus irregularis] Length = 264 Score = 53.9 bits (128), Expect(2) = 9e-12 Identities = 20/23 (86%), Positives = 23/23 (100%) Frame = -2 Query: 194 NHIWKVCQGLQSHAGGYRWEYVD 126 NHIWKVC+GLQ+HAGGYRWEYV+ Sbjct: 239 NHIWKVCRGLQAHAGGYRWEYVN 261 Score = 43.5 bits (101), Expect(2) = 9e-12 Identities = 31/67 (46%), Positives = 40/67 (59%), Gaps = 6/67 (8%) Frame = -1 Query: 393 ITYGYCSSGK-EFVNH-PGNPVK*SIQS-RMLYQKEN---AVRLRLQCQLAVKQIFDNES 232 + +CS + ++VNH GNP + + QKEN AVRL L Q AVKQIFD+ S Sbjct: 163 VALAFCSKEEGKYVNHIDGNPTNNNASNLEWCTQKENTQHAVRLGLGYQRAVKQIFDDGS 222 Query: 231 F*DFPSI 211 F +FPSI Sbjct: 223 FREFPSI 229