BLASTX nr result
ID: Ophiopogon25_contig00053650
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00053650 (460 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC02437.1| hypothetical protein RhiirA5_364139, partial [Rhi... 62 3e-08 gb|EXX72458.1| hypothetical protein RirG_069170 [Rhizophagus irr... 62 3e-08 gb|PKK61620.1| hypothetical protein RhiirC2_718295 [Rhizophagus ... 61 6e-08 gb|PKY46411.1| hypothetical protein RhiirA4_402463 [Rhizophagus ... 61 6e-08 >gb|PKC02437.1| hypothetical protein RhiirA5_364139, partial [Rhizophagus irregularis] Length = 295 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = -3 Query: 158 LPELSTSPPISQQLPQEYFPKDHNELDDDQKSNIHTTPDLTIDDLYHLMLNM 3 LP L+ S PIS QLP EY D E DD S +HTTP+LT+DDLYHL+LNM Sbjct: 170 LPSLAPSSPISHQLPAEYL--DFEEETDDH-SEVHTTPELTMDDLYHLVLNM 218 >gb|EXX72458.1| hypothetical protein RirG_069170 [Rhizophagus irregularis DAOM 197198w] dbj|GBC42673.1| hypothetical protein RIR_2582800 [Rhizophagus irregularis DAOM 181602] gb|PKC56944.1| hypothetical protein RhiirA1_428813 [Rhizophagus irregularis] gb|PKY30905.1| hypothetical protein RhiirB3_419157 [Rhizophagus irregularis] gb|POG69375.1| hypothetical protein GLOIN_2v1627972 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 328 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = -3 Query: 158 LPELSTSPPISQQLPQEYFPKDHNELDDDQKSNIHTTPDLTIDDLYHLMLNM 3 LP L+ S PIS QLP EY D E DD S +HTTP+LT+DDLYHL+LNM Sbjct: 203 LPSLAPSSPISHQLPAEYL--DFEEETDDH-SEVHTTPELTMDDLYHLVLNM 251 >gb|PKK61620.1| hypothetical protein RhiirC2_718295 [Rhizophagus irregularis] Length = 325 Score = 60.8 bits (146), Expect = 6e-08 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = -3 Query: 158 LPELSTSPPISQQLPQEYFPKDHNELDDDQKSNIHTTPDLTIDDLYHLMLNM 3 LP L+ S PIS QLP EY D E + D S +HTTP+LT+DDLYHL+LNM Sbjct: 200 LPSLAPSSPISHQLPAEYL--DFEE-ETDNHSEVHTTPELTMDDLYHLVLNM 248 >gb|PKY46411.1| hypothetical protein RhiirA4_402463 [Rhizophagus irregularis] Length = 328 Score = 60.8 bits (146), Expect = 6e-08 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = -3 Query: 158 LPELSTSPPISQQLPQEYFPKDHNELDDDQKSNIHTTPDLTIDDLYHLMLNM 3 LP L+ S PIS QLP EY D E + D S +HTTP+LT+DDLYHL+LNM Sbjct: 203 LPSLAPSSPISHQLPAEYL--DFEE-ETDNHSEVHTTPELTMDDLYHLVLNM 251