BLASTX nr result
ID: Ophiopogon25_contig00053608
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00053608 (483 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY45741.1| hypothetical protein RhiirA4_517723 [Rhizophagus ... 60 2e-07 gb|PKY20370.1| hypothetical protein RhiirB3_497554 [Rhizophagus ... 57 2e-06 >gb|PKY45741.1| hypothetical protein RhiirA4_517723 [Rhizophagus irregularis] Length = 1273 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -2 Query: 467 KFSQEAKSKVGSSPSSQKAKAKNMCQTLSKTLHSPLTF 354 + +QEAKSKVGSSPSSQK KAKN CQT SKTL SP TF Sbjct: 13 ELTQEAKSKVGSSPSSQKIKAKNRCQTPSKTLRSPPTF 50 >gb|PKY20370.1| hypothetical protein RhiirB3_497554 [Rhizophagus irregularis] Length = 1272 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = -3 Query: 481 APRNENFPRKLSPKSVQVQARKRPKRKICAKLCLKLFI 368 APRNENFPRKLSPKSVQVQARKR KRKI + L L + Sbjct: 24 APRNENFPRKLSPKSVQVQARKRSKRKIEIDIFLLLLL 61