BLASTX nr result
ID: Ophiopogon25_contig00053434
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00053434 (584 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC54831.1| hypothetical protein RhiirA1_403346 [Rhizophagus ... 57 1e-06 >gb|PKC54831.1| hypothetical protein RhiirA1_403346 [Rhizophagus irregularis] Length = 227 Score = 57.4 bits (137), Expect = 1e-06 Identities = 31/59 (52%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = -3 Query: 576 FIKKIASYHNSKAFRSFFIYNESCLQTA-EMLIPIEYRLSEIRLIVDGRKKYEEGRFGF 403 FIKKI Y+ SK+FR F+ +NES QTA EMLI E R+SE++L+ + K+ GR+GF Sbjct: 150 FIKKILKYYGSKSFREFYDFNESAFQTAVEMLIRPESRISEMQLVKNVNKR-SRGRYGF 207