BLASTX nr result
ID: Ophiopogon25_contig00053296
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00053296 (490 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC14344.1| duf866 domain protein [Rhizophagus irregularis D... 69 2e-11 gb|PKY43381.1| DUF866-domain-containing protein [Rhizophagus irr... 69 2e-11 gb|PKC67935.1| DUF866-domain-containing protein [Rhizophagus irr... 69 2e-11 gb|PKC15001.1| DUF866-domain-containing protein [Rhizophagus irr... 69 2e-11 emb|CDS07335.1| hypothetical protein LRAMOSA01284 [Lichtheimia r... 60 2e-08 gb|EIE85560.1| hypothetical protein RO3G_10270 [Rhizopus delemar... 59 8e-08 gb|OBZ82085.1| hypothetical protein A0J61_09863 [Choanephora cuc... 59 8e-08 gb|ORE11916.1| DUF866-domain-containing protein [Rhizopus micros... 58 2e-07 emb|CEJ00009.1| Putative DUF866 domain-containing protein [Rhizo... 58 2e-07 emb|CEG63243.1| Putative DUF866 domain-containing protein [Rhizo... 58 2e-07 emb|CEI85631.1| Putative DUF866 domain-containing protein [Rhizo... 57 3e-07 ref|XP_023471442.1| DUF866-domain-containing protein [Rhizopus m... 58 6e-07 gb|ORX43549.1| DUF866-domain-containing protein [Hesseltinella v... 56 8e-07 ref|XP_018297452.1| hypothetical protein PHYBLDRAFT_139441 [Phyc... 56 8e-07 gb|OAD02307.1| hypothetical protein MUCCIDRAFT_111677 [Mucor cir... 56 8e-07 emb|CDH58728.1| upf0587 protein c1orf123 homolog [Lichtheimia co... 56 8e-07 gb|ORZ17667.1| hypothetical protein BCR42DRAFT_238143 [Absidia r... 56 1e-06 emb|SAL99823.1| hypothetical protein [Absidia glauca] 54 4e-06 ref|XP_021881802.1| hypothetical protein BCR41DRAFT_352462 [Lobo... 54 6e-06 gb|EPB86915.1| hypothetical protein HMPREF1544_06341 [Mucor circ... 54 8e-06 >dbj|GBC14344.1| duf866 domain protein [Rhizophagus irregularis DAOM 181602] Length = 154 Score = 68.6 bits (166), Expect = 2e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 490 TKFEDIDLTEGDWVEYDEKGGVPVGISELQTEFRR 386 T FEDIDLTEGDW EYDEKGGVPVGISE+++EFRR Sbjct: 119 TVFEDIDLTEGDWAEYDEKGGVPVGISEIKSEFRR 153 >gb|PKY43381.1| DUF866-domain-containing protein [Rhizophagus irregularis] Length = 160 Score = 68.6 bits (166), Expect = 2e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 490 TKFEDIDLTEGDWVEYDEKGGVPVGISELQTEFRR 386 T FEDIDLTEGDW EYDEKGGVPVGISE+++EFRR Sbjct: 125 TVFEDIDLTEGDWAEYDEKGGVPVGISEIKSEFRR 159 >gb|PKC67935.1| DUF866-domain-containing protein [Rhizophagus irregularis] gb|PKY19513.1| DUF866-domain-containing protein [Rhizophagus irregularis] Length = 160 Score = 68.6 bits (166), Expect = 2e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 490 TKFEDIDLTEGDWVEYDEKGGVPVGISELQTEFRR 386 T FEDIDLTEGDW EYDEKGGVPVGISE+++EFRR Sbjct: 125 TVFEDIDLTEGDWAEYDEKGGVPVGISEIKSEFRR 159 >gb|PKC15001.1| DUF866-domain-containing protein [Rhizophagus irregularis] gb|PKK76073.1| DUF866-domain-containing protein [Rhizophagus irregularis] gb|POG74327.1| hypothetical protein GLOIN_2v1577878 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 160 Score = 68.6 bits (166), Expect = 2e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 490 TKFEDIDLTEGDWVEYDEKGGVPVGISELQTEFRR 386 T FEDIDLTEGDW EYDEKGGVPVGISE+++EFRR Sbjct: 125 TVFEDIDLTEGDWAEYDEKGGVPVGISEIKSEFRR 159 >emb|CDS07335.1| hypothetical protein LRAMOSA01284 [Lichtheimia ramosa] Length = 161 Score = 60.5 bits (145), Expect = 2e-08 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -1 Query: 490 TKFEDIDLTEGDWVEYDEKGGVPVGISELQTEFRRKK 380 T FEDIDL EG+W +YDEK G PVGI+E+Q EFR++K Sbjct: 125 TPFEDIDLEEGEWADYDEKAGEPVGINEIQVEFRKEK 161 >gb|EIE85560.1| hypothetical protein RO3G_10270 [Rhizopus delemar RA 99-880] Length = 142 Score = 58.5 bits (140), Expect = 8e-08 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = -1 Query: 490 TKFEDIDLTEGDWVEYDEKGGVPVGISELQTEFRRKK 380 T F DIDL+EG+W EYDEK G PVGIS+++ EFR++K Sbjct: 106 TVFNDIDLSEGEWAEYDEKSGEPVGISDIKVEFRKEK 142 >gb|OBZ82085.1| hypothetical protein A0J61_09863 [Choanephora cucurbitarum] Length = 161 Score = 58.9 bits (141), Expect = 8e-08 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -1 Query: 490 TKFEDIDLTEGDWVEYDEKGGVPVGISELQTEFRRKK 380 T FEDIDLTE +WVEYDEK G PVGI+ ++ EFR++K Sbjct: 125 TVFEDIDLTEKEWVEYDEKSGEPVGINNIEVEFRKEK 161 >gb|ORE11916.1| DUF866-domain-containing protein [Rhizopus microsporus var. microsporus] Length = 161 Score = 58.2 bits (139), Expect = 2e-07 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = -1 Query: 490 TKFEDIDLTEGDWVEYDEKGGVPVGISELQTEFRRKK 380 T F+DIDL+EG+W +YDEK G PVGIS ++ EFR++K Sbjct: 125 TTFDDIDLSEGEWADYDEKAGEPVGISNIEVEFRKEK 161 >emb|CEJ00009.1| Putative DUF866 domain-containing protein [Rhizopus microsporus] Length = 161 Score = 58.2 bits (139), Expect = 2e-07 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = -1 Query: 490 TKFEDIDLTEGDWVEYDEKGGVPVGISELQTEFRRKK 380 T F+DIDL+EG+W +YDEK G PVGIS ++ EFR++K Sbjct: 125 TTFDDIDLSEGEWADYDEKAGEPVGISNIEVEFRKEK 161 >emb|CEG63243.1| Putative DUF866 domain-containing protein [Rhizopus microsporus] Length = 161 Score = 58.2 bits (139), Expect = 2e-07 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = -1 Query: 490 TKFEDIDLTEGDWVEYDEKGGVPVGISELQTEFRRKK 380 T F+DIDL+EG+W +YDEK G PVGIS ++ EFR++K Sbjct: 125 TTFDDIDLSEGEWADYDEKAGEPVGISNIEVEFRKEK 161 >emb|CEI85631.1| Putative DUF866 domain-containing protein [Rhizopus microsporus] Length = 161 Score = 57.4 bits (137), Expect = 3e-07 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -1 Query: 490 TKFEDIDLTEGDWVEYDEKGGVPVGISELQTEFRRKK 380 T F DIDL+EG+W +YDEK G PVGIS ++ EFR++K Sbjct: 125 TTFNDIDLSEGEWADYDEKAGEPVGISNIEVEFRKEK 161 >ref|XP_023471442.1| DUF866-domain-containing protein [Rhizopus microsporus ATCC 52813] gb|PHZ17734.1| DUF866-domain-containing protein [Rhizopus microsporus ATCC 52813] Length = 303 Score = 58.2 bits (139), Expect = 6e-07 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = -1 Query: 490 TKFEDIDLTEGDWVEYDEKGGVPVGISELQTEFRRKK 380 T F+DIDL+EG+W +YDEK G PVGIS ++ EFR++K Sbjct: 267 TTFDDIDLSEGEWADYDEKAGEPVGISNIEVEFRKEK 303 >gb|ORX43549.1| DUF866-domain-containing protein [Hesseltinella vesiculosa] Length = 158 Score = 56.2 bits (134), Expect = 8e-07 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = -1 Query: 490 TKFEDIDLTEGDWVEYDEKGGVPVGISELQTEFRRKK 380 T F+D+DLTEG+W EYDE+ G PVGIS + EFR+ K Sbjct: 122 TVFDDVDLTEGEWAEYDEEAGEPVGISNFEVEFRKIK 158 >ref|XP_018297452.1| hypothetical protein PHYBLDRAFT_139441 [Phycomyces blakesleeanus NRRL 1555(-)] gb|OAD79412.1| hypothetical protein PHYBLDRAFT_139441 [Phycomyces blakesleeanus NRRL 1555(-)] Length = 159 Score = 56.2 bits (134), Expect = 8e-07 Identities = 22/37 (59%), Positives = 31/37 (83%) Frame = -1 Query: 490 TKFEDIDLTEGDWVEYDEKGGVPVGISELQTEFRRKK 380 TKFEDIDL EG+W EYD+K PVGIS+++ +F+++K Sbjct: 123 TKFEDIDLLEGEWAEYDDKSNEPVGISDIEIKFKKEK 159 >gb|OAD02307.1| hypothetical protein MUCCIDRAFT_111677 [Mucor circinelloides f. lusitanicus CBS 277.49] Length = 161 Score = 56.2 bits (134), Expect = 8e-07 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -1 Query: 490 TKFEDIDLTEGDWVEYDEKGGVPVGISELQTEFRRKK 380 T FE+IDL E +W EYDEK G PVGIS +Q EFR++K Sbjct: 125 TVFEEIDLCEDEWAEYDEKSGEPVGISSIQVEFRKEK 161 >emb|CDH58728.1| upf0587 protein c1orf123 homolog [Lichtheimia corymbifera JMRC:FSU:9682] Length = 161 Score = 56.2 bits (134), Expect = 8e-07 Identities = 22/37 (59%), Positives = 30/37 (81%) Frame = -1 Query: 490 TKFEDIDLTEGDWVEYDEKGGVPVGISELQTEFRRKK 380 T+FEDID EGDW +YDEK PVGI+E++ EF+++K Sbjct: 125 TRFEDIDFEEGDWADYDEKSEEPVGINEIEVEFKKEK 161 >gb|ORZ17667.1| hypothetical protein BCR42DRAFT_238143 [Absidia repens] Length = 183 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/37 (59%), Positives = 30/37 (81%) Frame = -1 Query: 490 TKFEDIDLTEGDWVEYDEKGGVPVGISELQTEFRRKK 380 T F+DIDL EGDW +YDEK G PVGIS ++ +F+++K Sbjct: 147 TSFDDIDLLEGDWADYDEKAGEPVGISGIEVQFKKEK 183 >emb|SAL99823.1| hypothetical protein [Absidia glauca] Length = 132 Score = 53.9 bits (128), Expect = 4e-06 Identities = 20/37 (54%), Positives = 30/37 (81%) Frame = -1 Query: 490 TKFEDIDLTEGDWVEYDEKGGVPVGISELQTEFRRKK 380 T F+DIDL EG+W +YDEK G PVGI+ ++ +F+++K Sbjct: 96 TTFDDIDLLEGEWADYDEKAGEPVGIANIEVQFKKEK 132 >ref|XP_021881802.1| hypothetical protein BCR41DRAFT_352462 [Lobosporangium transversale] gb|ORZ17415.1| hypothetical protein BCR41DRAFT_352462 [Lobosporangium transversale] Length = 160 Score = 53.9 bits (128), Expect = 6e-06 Identities = 22/37 (59%), Positives = 30/37 (81%) Frame = -1 Query: 490 TKFEDIDLTEGDWVEYDEKGGVPVGISELQTEFRRKK 380 T FEDIDLT+GDW +YDEK +PVGIS ++++F + K Sbjct: 124 TVFEDIDLTDGDWADYDEKSQMPVGISNIESKFIKTK 160 >gb|EPB86915.1| hypothetical protein HMPREF1544_06341 [Mucor circinelloides f. circinelloides 1006PhL] Length = 161 Score = 53.5 bits (127), Expect = 8e-06 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = -1 Query: 490 TKFEDIDLTEGDWVEYDEKGGVPVGISELQTEFRRKK 380 T FE+IDL E +W EYDEK G PVGIS + EFR++K Sbjct: 125 TVFEEIDLCEDEWAEYDEKSGEPVGISNILVEFRKEK 161