BLASTX nr result
ID: Ophiopogon25_contig00053281
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00053281 (425 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC34997.1| biogenesis of lysosome-related organelles comple... 111 2e-28 gb|EXX70983.1| hypothetical protein RirG_082580 [Rhizophagus irr... 111 2e-28 gb|PKB99620.1| hypothetical protein RhiirA5_366321 [Rhizophagus ... 109 1e-27 >dbj|GBC34997.1| biogenesis of lysosome-related organelles complex 1 subunit 5-like [Rhizophagus irregularis DAOM 181602] gb|PKC56826.1| hypothetical protein RhiirA1_428894 [Rhizophagus irregularis] gb|PKK61931.1| hypothetical protein RhiirC2_760198 [Rhizophagus irregularis] gb|PKY26632.1| hypothetical protein RhiirB3_415387 [Rhizophagus irregularis] gb|PKY44450.1| hypothetical protein RhiirA4_399891 [Rhizophagus irregularis] gb|POG78860.1| hypothetical protein GLOIN_2v1532706 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 158 Score = 111 bits (278), Expect = 2e-28 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = +1 Query: 1 NRQSRSDPYQKERKEFLKGIEKAKRNYEEEIKEREQELVKEYRLLMEEAVRGVAPP 168 NRQSRSDPYQKERKEFLKGIEKAK+NYEEE+KEREQELVKEYRLLMEEAVRGVAPP Sbjct: 103 NRQSRSDPYQKERKEFLKGIEKAKKNYEEEMKEREQELVKEYRLLMEEAVRGVAPP 158 >gb|EXX70983.1| hypothetical protein RirG_082580 [Rhizophagus irregularis DAOM 197198w] Length = 162 Score = 111 bits (278), Expect = 2e-28 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = +1 Query: 1 NRQSRSDPYQKERKEFLKGIEKAKRNYEEEIKEREQELVKEYRLLMEEAVRGVAPP 168 NRQSRSDPYQKERKEFLKGIEKAK+NYEEE+KEREQELVKEYRLLMEEAVRGVAPP Sbjct: 107 NRQSRSDPYQKERKEFLKGIEKAKKNYEEEMKEREQELVKEYRLLMEEAVRGVAPP 162 >gb|PKB99620.1| hypothetical protein RhiirA5_366321 [Rhizophagus irregularis] Length = 158 Score = 109 bits (272), Expect = 1e-27 Identities = 53/56 (94%), Positives = 55/56 (98%) Frame = +1 Query: 1 NRQSRSDPYQKERKEFLKGIEKAKRNYEEEIKEREQELVKEYRLLMEEAVRGVAPP 168 NRQSRSDPYQKERKEFLKGIEKAK+NYEEE+KEREQELVKEY LLMEEAVRGVAPP Sbjct: 103 NRQSRSDPYQKERKEFLKGIEKAKKNYEEEMKEREQELVKEYSLLMEEAVRGVAPP 158